(data stored in ACNUC7421 zone)

EMBL: AP011115.PE173

AP011115.PE173       Location/Qualifiers
FT   CDS_pept        complement(151668..153749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH1"
FT                   /protein_id="BAH48420.1"
FT                   /translation="MEGTGPSSIPLGDLLNSRRRRTYVGREGERELVRARLESADPQWS
FT                   VLYLHGPGGIGKTALLDVLAEIAEDVGATVVRLDGRDLSPSPSAILAALSDAVEVPVTG
FT                   VITSTEERLCVLVDSYEVLGPIDEWMRTRLLPRLPATALTVIAARTPPSPQWRADAAWS
FT                   ALLRVVSLRNLTPGECREFLRAVAVSTQLHDRICQVTHGHPLALSLLADVASRGGEVAA
FT                   DPLTPDLIGVLMQRFIEVVPSPVHRRALEVCALARVTTESLLRDVLELDDAHEVFAWLR
FT                   QLSFVEAGPEGLFPHDLARDVVDVDLRWRDLDFYTEVFHRVWRHLRRRLTSCSGREQQR
FT                   VIFDLKFVFRNLPGVLSPVDWESWGHHYPEPACEEDRETIVELVRSHEGAESAEIAAAW
FT                   FRRQPEGFYIVRRPDGTARGFFGLLDLSRASADDIAADPGAAAAWDFARTQSPPREGEA
FT                   ITQTRFVIDATAYQDPSPTLNAIPIMTMQRYLCTPRLSWDFLTLAEPDRWNEYFAVADL
FT                   PRAGGADFEVGARRYGLFSHDFRRVPVDAWFEQVAVRALSDNPVAPKRPAPQLLVLSQP
FT                   EFEQAVRQALHDWRRPDLLRRNPLMRTRVVCDRGGAEPDVAELDTVLRDAVDALADDPR
FT                   DDKMVRAVDRTYLRPAATQEAAAQILGLPFSTYRRHLTQGVAQVVSWLWDREIYGRHE"
     atggagggca cagggccgtc ctcgataccg ctcggagatc tgctgaactc gcggcgccgg        60
     cgaacctacg tcggccgcga gggggagcgt gaattggtcc gggccaggct ggagtcggcc       120
     gatccgcagt ggtccgtgct gtacctgcac ggtcccggag ggatcgggaa gaccgcactg       180
     ctcgacgtgc tggccgagat cgccgaggac gtgggcgcca cggtcgttcg gctcgacggc       240
     cgcgacctct cgccgtcgcc ctccgccatc ctcgcggcgt tgagcgacgc cgtcgaggtg       300
     cccgtcaccg gcgtgatcac gtccacggag gaacggctct gcgtccttgt cgacagctat       360
     gaggtgctgg ggccgatcga cgagtggatg cgtactcggt tgctgccgcg gctaccggcg       420
     acggcgctca ctgtgatcgc ggcccggaca ccgcccagcc cacaatggcg ggccgatgcg       480
     gcgtggagtg cactgttgcg ggtcgtgtcc ctgcgaaacc tcaccccggg ggagtgccgg       540
     gagtttcttc gcgcggtggc ggtgtcgacg cagttgcacg atcggatctg ccaggtcacg       600
     cacgggcatc cgctggcgct gtcattgctg gccgacgtgg catcccgggg tggcgaggtc       660
     gccgccgatc cgttgacccc cgacctcatc ggggtgctca tgcaacggtt catcgaggtg       720
     gtgccgagtc ccgtgcaccg ccgggcgctc gaggtgtgcg ccctcgcccg ggtgaccacc       780
     gagtccctgc tgcgggacgt cctcgaactc gacgatgcgc atgaggtgtt cgcgtggctg       840
     cggcagttgt cgttcgtcga ggcaggcccg gagggactgt tcccgcacga tctggctcgc       900
     gacgtcgtcg acgtggatct gcggtggcgc gacctcgact tctacacgga ggtgttccac       960
     cgcgtgtggc ggcacctccg tcgccggttg acctcgtgta gcgggcgcga acagcagcgc      1020
     gtgatcttcg acctgaaatt cgtgttccgg aatcttcccg gggtcctgtc ccctgtggac      1080
     tgggagtcgt ggggccacca ctacccggag cccgcatgcg aggaggatcg cgagacgatc      1140
     gtcgagttgg tccgctccca cgagggtgcg gagtcggcgg agatagccgc cgcgtggttc      1200
     cggcgccaac cggaggggtt ctacatcgtg cgccgtcccg acggcacggc ccgtgggttc      1260
     ttcggtctgc tcgatctgag ccgcgcgtcc gccgacgaca tcgccgccga tcccggtgcc      1320
     gcggctgcct gggacttcgc ccgcacccag tcgccgccca gagaagggga ggcgatcacc      1380
     cagacccggt tcgtcatcga cgccaccgcc tatcaggacc cgtcgcccac gttgaacgcg      1440
     atcccgatca tgaccatgca gcggtacctg tgcaccccga ggctgtcctg ggacttcctc      1500
     accctggccg agccggaccg gtggaacgag tatttcgcgg ttgccgacct tccgcgggcc      1560
     gggggcgccg atttcgaggt cggtgcgcgg aggtatgggc tgttctcaca cgacttccgt      1620
     cgcgtcccgg tggatgcctg gttcgagcag gtcgccgttc gcgcattgtc cgacaatccc      1680
     gttgcaccca agcggccggc gccgcaactg ctggtgctgt cccaacccga gttcgagcag      1740
     gcggtccggc aggcgctgca cgactggcgc cgccccgacc tgctccggcg gaatccgttg      1800
     atgcgcactc gggtcgtgtg cgatcgcggc ggcgccgagc cggatgtcgc tgaactggac      1860
     accgtgctcc gcgacgcggt ggacgccctg gccgacgatc cccgcgacga caaaatggta      1920
     cgtgcggtcg accggacgta tctgcgcccg gccgcgaccc aggaggccgc cgcccagatc      1980
     ctcgggttgc cgttcagcac gtatcggcgc cacctcacac agggggttgc gcaggtcgtc      2040
     tcgtggttgt gggatcgcga aatctacgga cgtcacgagt ga                         2082
//

If you have problems or comments...

PBIL Back to PBIL home page