(data stored in ACNUC7421 zone)

EMBL: AP011115.PE176

AP011115.PE176       Location/Qualifiers
FT   CDS_pept        complement(155001..155600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01760"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48423"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASH4"
FT                   /protein_id="BAH48423.1"
FT                   /translation="MKIMKARSKVEVAAAVGAGYLLGRTHQLRMAVKIAGAGGRCPMGP
FT                   EDLLAQGSEFLAASPEIADLGDSVRDELLDTAAATAEASSEHVGSFRDRVRSGGAHFVA
FT                   GGGNLVAGVKRIGRRGHAHPRDPEDSTVDGALDHGKGEDGPSSPAVQEERQPKPRRRRK
FT                   PRITTPSDSAGASRDESAPEARPDTAARRKGTAKAH"
     atgaaaataa tgaaggccag atccaaagtt gaggttgccg cagcggtcgg cgccgggtac        60
     ctactggggc gtacgcacca gttgagaatg gccgtgaaga ttgctggtgc gggcgggcgg       120
     tgccccatgg ggcctgagga tctgctcgca cagggatccg agttcctggc cgcgtctccg       180
     gagatcgcgg atctcggcga ttcggttcgg gatgagctac tcgacacggc ggcggcgacg       240
     gccgaggcca gcagcgagca cgtcggttcg ttccgcgacc gcgtccggtc gggcggcgcg       300
     cacttcgtgg ccggcggtgg gaatttggtc gccggggtga agaggattgg ccgtcgcggg       360
     cacgcccacc cgcgggaccc cgaggattcc accgtcgacg gggcgctgga ccacggaaaa       420
     ggcgaggacg gaccatcctc tccggcggtc caagaagaac gacagccgaa gcctcgcaga       480
     cggcgcaaac cacggatcac gacccccagc gactcggcgg gggcgtcccg ggacgaatcc       540
     gcaccggaag cacgaccgga cacagccgca cggcggaagg gaacggctaa ggctcactag       600
//

If you have problems or comments...

PBIL Back to PBIL home page