(data stored in ACNUC7421 zone)

EMBL: AP011115.PE182

AP011115.PE182       Location/Qualifiers
FT   CDS_pept        complement(158423..158701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48429"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI0"
FT                   /protein_id="BAH48429.1"
FT                   /translation="MSSQSVIDLGAAGAASVAQTEPIGPNGPTGGPCPIVTTYSQGNET
FT                   VTYGKPGDRNGALVCGADGEWTIGRSKGNPGQIQTQPGLSVGWEMTP"
     gtgtcatccc aatccgttat cgacctgggt gcggccggag cggcgtccgt cgctcagacc        60
     gagccgatcg gcccgaacgg tcccaccggt ggtccgtgcc cgatcgtgac cacgtactcg       120
     cagggtaatg agacggtgac ctacggcaaa cccggtgacc gcaacggtgc cctggtgtgc       180
     ggtgcggacg gtgaatggac gatcggtagg tcgaagggca accccgggca gatccagact       240
     cagcccggtc tgtcggtcgg atgggagatg actccctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page