(data stored in ACNUC7421 zone)

EMBL: AP011115.PE188

AP011115.PE188       Location/Qualifiers
FT   CDS_pept        165068..166054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01880"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48435"
FT                   /db_xref="GOA:C1ASI6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI6"
FT                   /protein_id="BAH48435.1"
FT                   /translation="MDSTIPDENVVRIAVDLACRAPSVHNSQPWQWTYTDGQLDLYTAR
FT                   GRVLASTDPTGRQLVVSCGAALHHLQTALTALKWAADVRRVPEGPHSGHLATIRFRHEA
FT                   RPQSHDFDLLAAIRHRHSDRRPFGPVSVKTPLPAALNDVVHRRDVNLTVLRQEARPTLA
FT                   RATETTAAARKYDTAYQAELHWWAGHSIAQGGIPPDALATADDRDRVDIGRRFPAGLDA
FT                   GATTEPDRSTVLVLSTAADGRGEWLRAGEALSAVLLEATVGGLSTCPLTHMTELRQGRD
FT                   IIRDLLPDRGFPQALIRVGTTEKKSAPRQTPRRPVESVLSVGRRIPH"
     gtggacagca ccattcccga cgagaacgtc gtccgaatcg ccgtggacct tgcctgccgg        60
     gcgccgtcgg tacacaacag ccagccgtgg caatggacct acaccgacgg ccaactcgac       120
     ctctacaccg cacgcggccg cgtcctggct tccaccgacc cgacgggccg gcagttggtc       180
     gtcagctgcg gtgcagcact gcatcatctc cagacggcgc tgactgcact caaatgggca       240
     gcggacgtcc ggcgtgtccc ggaggggccg cactcgggtc acctggcgac gatccggttc       300
     cgtcacgagg cccggcccca gtcgcacgac ttcgatctgc tcgccgcgat ccggcaccgg       360
     cactccgacc gcaggccctt cgggccggtc agcgtgaaga cgccgctgcc cgccgcgctg       420
     aacgacgtgg tacaccgccg agacgtgaac ctgaccgtgc tgaggcagga ggcgcgaccg       480
     acgctcgcgc gagcaacgga aacgaccgcg gccgcacgaa agtacgacac cgcctaccag       540
     gccgagctgc attggtgggc cggtcattcc atcgctcagg gcggaattcc ccccgatgcg       600
     ctcgccaccg cggacgaccg ggaccgcgtc gacatcgggc gtcgcttccc cgccggcctg       660
     gacgccggtg cgaccacgga gccggaccgc tcgacggtgc tggtgttgag cacggccgcg       720
     gacggtcgcg gtgagtggct ccgcgccgga gaggccctgt cggcggtgct gctcgaggcc       780
     accgtcggcg gtttgtcgac ctgtccgctc acccacatga ccgaactccg tcagggcagg       840
     gacatcatcc gcgacctgct ccccgaccgc gggttcccgc aggcgctgat cagggtgggt       900
     actaccgaga agaagtcggc accgcggcag acaccgagac ggcccgtcga atcggtcctc       960
     tccgtcggcc gccgcatccc ccactga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page