(data stored in ACNUC7421 zone)

EMBL: AP011115.PE189

AP011115.PE189       Location/Qualifiers
FT   CDS_pept        complement(166082..166426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01890"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48436"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASI7"
FT                   /protein_id="BAH48436.1"
FT                   /translation="MNTPIRDFDVEGSTEWTIPALLNETTWLVEVVVDEHDSDEGGSRI
FT                   RAQARLRTRDTRTFVGSGLARRNPDDAEISEIGEVLATARALSDLAHQLIEATAADVET
FT                   ATHSRVHLAG"
     atgaataccc ccattcgcga cttcgacgtt gaagggagca cggagtggac gatccctgcc        60
     cttcttaacg agacgacatg gctggtggag gtcgtcgtcg acgaacacga ctcggatgaa       120
     ggcggctcca gaatccgcgc gcaggctcgg ctccgaaccc gcgacacccg cacgttcgtc       180
     gggtccgggc tcgcccgccg gaacccggac gatgccgaaa tctccgagat cggagaggta       240
     ttggccaccg cacgcgcgct gtccgacctc gcccaccaac tgatcgaggc gaccgcggcc       300
     gacgtggaaa cagccactca cagccgagtc catctcgccg gataa                       345
//

If you have problems or comments...

PBIL Back to PBIL home page