(data stored in ACNUC7421 zone)

EMBL: AP011115.PE196

AP011115.PE196       Location/Qualifiers
FT   CDS_pept        complement(171751..172407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01960"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01960"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48443"
FT                   /db_xref="GOA:C1ASJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ4"
FT                   /protein_id="BAH48443.1"
FT                   /translation="MADMQREKQFRRLRTPRSAAVAGIVFAAFFSASLVLLHTALPADP
FT                   FDETPWVGSGETRIKTALVLAPFAGIAFLWFIGVIRDRLGDLEDRFFATVFLGSGLLFL
FT                   AMGFISMGVAGGVLAIARHSGSSADEIVYFGREIMLQINHVYALRMAAVFMLSLGTIWL
FT                   RTGLMPRFLVVTTYLLALALLLVVSFSLWTTLAFPAWVLLVSIYILVTGRRIRAA"
     atggccgaca tgcagcgcga gaaacagttc cgccggctga gaacgccacg ctcggcggcc        60
     gtcgcgggca tcgtgttcgc tgcgttcttc tccgccagcc tcgtcctcct gcacaccgca       120
     ctgcccgccg acccgttcga cgagacaccc tgggtgggaa gcggtgagac ccggatcaag       180
     acggccctcg tgctcgcccc gttcgcgggc atcgcgttcc tctggttcat cggcgtcatc       240
     cgcgaccgcc tcggcgacct cgaggaccgt ttcttcgcga cggtattcct gggtagcggc       300
     ctgctgttcc tcgcgatggg cttcatctcg atgggcgtcg cgggcggcgt cctcgcgatc       360
     gcccggcact cgggcagttc cgcggacgag atcgtctact tcggccgcga gatcatgctg       420
     cagatcaacc acgtatacgc gctgcgcatg gctgcggtgt tcatgctctc gctgggaacg       480
     atctggctcc ggaccgggct gatgccgcga ttcctcgtcg tgaccacata cctgctcgcc       540
     ctggctctgc tgctggtcgt cagcttcagc ctgtggacga cactggcttt cccggcctgg       600
     gtgcttctgg tcagcatcta catcctcgtc accggtcggc gcattcgcgc cgcctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page