(data stored in ACNUC7421 zone)

EMBL: AP011115.PE197

AP011115.PE197       Location/Qualifiers
FT   CDS_pept        172740..174248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01970"
FT                   /product="putative drug resistance efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48444"
FT                   /db_xref="GOA:C1ASJ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ5"
FT                   /protein_id="BAH48444.1"
FT                   /translation="MMVTHAPDGGSARTRQQDATDERWTPRLIFSLASIVLLLEMLAVS
FT                   YMMISIALPQIVTHYRTTQGAWLLTSFLLVGAITCPLIGKLADTHGKRKLLLTAVGLSA
FT                   LGSLISAIAPTYAVLIAGRSLTGLLVPCLFLSYSLIRDVFPARTVALAVSIATSGMGLI
FT                   AIPAPFFTGWLIDNFGFRSIFWFFLAGLVVLAVLIRATTGESPVRLRSRIDLIGAALLG
FT                   AGLAGILVGVSFGPSWGWTSGSTLGFVAGGVALLVAWIGSALLLSDPLIDIRFFGKRPV
FT                   FLTALGAGFCYGTSSVFTIMLPMMCMTPAILGLGYGFGISAEGFAIFQAPLGGAVVLGG
FT                   LIVGTLVPRNVRPRILMVVGMLVMAAACLLTATIHDDKALLIGFAALLGVGMGMGYASI
FT                   PNLLIAAVPPQLQATTASMVAVFQSILPAILPVIAFTVLNSHIATVMQGAVFYTDTGIT
FT                   IAFVIGAISALLGAMVAVALPRRISQLSAPGAESTTATDVVLAH"
     atgatggtca cccatgcgcc ggacggcgga tcggctcgga cgcgtcagca ggacgcgacc        60
     gacgagcgat ggacgccccg actgatcttc tcgctcgcct cgatcgtgtt actgctggag       120
     atgctcgcgg tcagctacat gatgatctcg atcgcgctgc cgcagatcgt cacccattac       180
     cggacgaccc agggggcgtg gctgctcacg tcgttcctgc tggtgggggc gatcacctgc       240
     ccgctgatcg gcaagctcgc cgacacccac ggcaagagga agctgctgct gacggccgtc       300
     ggcctgtcgg cgctgggctc gctgatctcg gcgatcgcac cgacgtacgc ggtgctgatc       360
     gccggccgct cgctgaccgg gctgctcgtg ccgtgcctgt tcctgagcta ttcgctgatc       420
     cgtgacgtct tccccgcccg gacggtggcg ctggcggtca gcatcgccac gagcggcatg       480
     gggctcatcg cgatccccgc gccgttcttc accggttggc tgatcgacaa cttcgggttc       540
     cgcagcatct tctggttctt cctggccggt ctcgtggtcc tcgccgtcct gatccgggcg       600
     acgaccggcg aatcgcccgt ccgcctgcgt tcgcgcatcg acctgatcgg cgccgcgctg       660
     ctcggcgcgg gactcgccgg catcctcgtc ggggtgagct tcgggccgtc gtggggctgg       720
     acgtcggggt cgaccctcgg gttcgtcgcc ggcggtgtcg ccctgctggt ggcgtggatc       780
     ggatccgcac ttctgctgtc ggatccgctg atcgacatcc ggttcttcgg caagcggccc       840
     gtcttcctga cggcattggg cgccggattc tgctacggga cgtcgtcggt gttcacgatc       900
     atgctcccga tgatgtgcat gacgccggcg atcctggggc tcggctacgg attcggcatc       960
     agcgcagagg gatttgcgat cttccaggcg ccgttgggtg gtgcggtagt gctcggcgga      1020
     ctgatcgtcg gaaccctggt accccggaac gtgcggccgc ggatcctgat ggtcgtgggc      1080
     atgctggtga tggcggcggc ctgcctgctc acggcgacga tccacgacga caaggcactg      1140
     ctcatcggct tcgccgccct cctgggcgtg ggaatgggca tggggtacgc ctccatcccg      1200
     aacctgctca tcgcagcggt gccgccgcaa ctgcaggcga cgacggcgag catggtggcg      1260
     gtgttccaga gcattctgcc cgccatcctt ccggtcatcg ccttcaccgt gttgaactcg      1320
     cacattgcga ccgtgatgca gggcgccgtc ttctacacgg acaccggtat cacgatcgct      1380
     ttcgtgatcg gcgcgatctc ggcgctgctg ggcgccatgg tggccgtcgc gctgccccgc      1440
     aggatttcgc agctgagcgc acccggcgcc gagtccacga ccgcgaccga cgtggtcctc      1500
     gcccactga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page