(data stored in ACNUC7421 zone)

EMBL: AP011115.PE198

AP011115.PE198       Location/Qualifiers
FT   CDS_pept        174413..174883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01980"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48445"
FT                   /db_xref="GOA:C1ASJ6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ6"
FT                   /protein_id="BAH48445.1"
FT                   /translation="MRSGEAAACLNVSVVGVRKAASAGRLPSRRTGSGQRVFDRADLDV
FT                   YLGRPTWKNVRADRAEASYCRVSGSTGQKSSLADQEKMLRESATGTVYRVYKDRGSGLR
FT                   ETRTGLNRMLDDATKGRFTVVRVVWRDRLARFSGGVDRTLPVGGRRQGRGPA"
     atgcgcagcg gcgaggcggc ggcatgcctg aacgtgtcgg tggtgggggt ccggaaggcc        60
     gcgtcggcgg gccggttacc ttctcggcgt acaggttccg gtcagcgagt cttcgatcgg       120
     gcggatctcg acgtctacct gggtcgacct acatggaaga atgttcgggc cgacagggcg       180
     gaagcatcct attgccgggt gtccggctcg accggtcaga aatcctcgct cgccgatcag       240
     gagaagatgt tgcgtgagag tgccaccggc accgtgtacc gggtctacaa ggatcgtggt       300
     tccggtctgc gggagacccg aacgggactg aatcggatgc tcgacgacgc aaccaagggc       360
     cggttcacgg tggtgcgagt ggtatggcgg gatcggttgg cgcgattctc cggtggcgtg       420
     gatcgaacgt tacctgtcgg cggtcggcgt caaggtcgag gtcctgcgtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page