(data stored in ACNUC7421 zone)

EMBL: AP011115.PE199

AP011115.PE199       Location/Qualifiers
FT   CDS_pept        174920..175681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_01990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48446"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ7"
FT                   /protein_id="BAH48446.1"
FT                   /translation="MTSWHCSPRFPAASAQLRSKRNQRRLRWRCGSTVGEDYLMADAGL
FT                   PAVRQFSFTARPYLAVDDVTGEPIGLDGVDTRVGWLLDLISGAEAQMLSRLWQPATFDV
FT                   LAAGVDRQDRRLPAQGHVAASRLGWTPHYPDGVYIPSRVTRVVTAQVMATLRTLAFRDT
FT                   AITSLSERFDPATGQIAPPTCAADWVPLGFARGVRRQLIARSRREGNAVPSGRVRITDM
FT                   QAPPKTSVMARLSAADRQLAQLAVTDVVMTL"
     atgacttcat ggcattgctc gcctcgtttt ccggccgctt ccgcccaatt gcggtcgaag        60
     cggaatcaac gtcgacttcg ttggcgatgc ggcagcacgg ttggcgagga ctacctgatg       120
     gccgatgccg gattgcctgc ggtgcggcag ttctcgttca ccgcccgccc gtacctcgct       180
     gtcgatgacg tcactggtga gccgatcggg ctcgacggcg tcgacacccg ggtggggtgg       240
     ttgctcgacc tgatctcggg cgccgaagcg cagatgctgt cgcggctgtg gcagccggcc       300
     accttcgatg tcctcgccgc cggcgtggac cggcaggacc ggaggctgcc cgcgcagggt       360
     cacgtcgccg cgtcccgcct cggctggacc ccgcattacc cggacggggt ctacattccg       420
     tcgcgtgtca cgcgggtggt gaccgcgcag gtgatggcga ccctgcggac cctcgccttc       480
     cgggacaccg cgatcacatc gctgtctgag cggttcgacc cggccaccgg gcagatagcc       540
     ccacccacct gcgccgcgga ctgggtgcca ttgggtttcg cccgaggagt gcgacgccag       600
     ctgattgccc gctcccgccg cgagggcaac gcggtgccgt ccggccgggt gcggatcacc       660
     gacatgcagg caccaccgaa gacctcggtg atggctcggc tgtccgcagc ggatcggcag       720
     ctcgctcaac tcgccgtcac cgacgtcgtc atgacgttgt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page