(data stored in ACNUC7421 zone)

EMBL: AP011115.PE2

AP011115.PE2         Location/Qualifiers
FT   CDS_pept        1300..1557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48249"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS00"
FT                   /protein_id="BAH48249.1"
FT                   /translation="MTQKIDMVDPRHGRREMSAHALRIPRRRPLSDTLAEAFPELHRAA
FT                   LPDQTLFYGNHVHFGIPSGTLTPPSFRLPCGRRRERRVSG"
     ttgacgcaga agatcgacat ggtcgaccca cgtcacggcc gtcgagaaat gagtgcacat        60
     gcgctacgaa ttccgcgtcg ccgacctctg tcggacacac tcgccgaagc tttccccgaa       120
     ctacaccgcg ccgccctgcc cgaccagacc ctgttctacg gcaaccacgt ccacttcggc       180
     ataccctccg gcaccctcac cccgccttcg tttcggctcc cgtgcggccg ccgacgggag       240
     cggagagttt ctggttga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page