(data stored in ACNUC7421 zone)

EMBL: AP011115.PE200

AP011115.PE200       Location/Qualifiers
FT   CDS_pept        175678..176772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02000"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48447"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASJ8"
FT                   /protein_id="BAH48447.1"
FT                   /translation="MKLPTTPVPTGRAQWRRVRLTATLPAHLHDRPISDWHLPTLVLDH
FT                   RGLLLRCAATETVPAAELTSGTTAVGVDWSPATLGAAAITTETPDGLSSDFQGWTYDDD
FT                   RGLGTKLARLQAEGHMLHRKAARLTQLATNAEPEVRTQLEAKIALLDAHRTAVGAKRGK
FT                   INRELGFHFARQVTDYATAASATVIAVEDLTTLESRGHGRVNNNRAAQSARRKAVIALA
FT                   HTAAGVGITVVSVPARGSSARCPGCDAPLARPGGYHTAWCQGCRVGGNRDHIAGVNRAK
FT                   RALLGKTKVTRRRGQMPAIRVAEHAPVRKSRDKTGPTPRPPRHRRVRRSLPTVTPRAGV
FT                   TPKQICSCTSSVGVGHGPTRTTSE"
     gtgaaactgc ccaccactcc cgtcccgacg ggacgcgcgc agtggcgacg agtccggctg        60
     accgccacac tccccgcgca cctgcacgac cggccgatca gcgactggca tctgccgacc       120
     ctcgtcctcg accaccgagg tctgctgttg cggtgcgccg ccaccgagac ggtccccgca       180
     gccgagctga catcgggaac taccgctgtg ggcgtcgact ggtcgccggc cacgctcggt       240
     gccgccgcca tcaccaccga aaccccggac gggctgtcct cggactttca gggttggacg       300
     tacgacgacg accgcggcct cgggaccaaa ctggcccgcc tgcaagcgga ggggcacatg       360
     ttgcaccgca aggcggcccg gctgacgcaa ctcgccacca acgccgaacc cgaggtccgc       420
     acccaactcg aggcgaagat cgccctcctc gacgcccacc gcaccgcggt gggtgccaag       480
     aggggcaaga tcaaccggga actgggattc cacttcgccc gccaggtcac cgactatgcc       540
     accgcggcga gcgcgacggt gatcgcggtg gaggacctga ccaccctcga gtcccgcggg       600
     cacggtcggg tcaacaacaa tcgggccgcg cagtccgccc gccgaaaggc ggtgatcgcc       660
     ctcgcgcaca ccgccgcggg tgtcggcatc acggtggtgt cggtgccggc ccgcggatcc       720
     tccgcgcggt gtccgggctg cgacgcaccc ctcgcacgcc ccggcggcta ccacaccgcg       780
     tggtgccagg ggtgccgggt cggcggcaac cgggaccata tcgccggggt caaccgggcc       840
     aaacgcgcac tgctcggcaa aaccaaggtg acccgtcggc gggggcagat gcccgcgatc       900
     cgggtcgccg agcacgcgcc ggtccgcaag tcccgggaca agaccggtcc gacaccgcgt       960
     ccgccgcggc accgcagggt ccgccgcagc ctgcccaccg tgacaccgcg ggcgggggtg      1020
     actccgaaac agatatgttc ctgcacctcg agcgtcggtg tgggacacgg tccaacccgc      1080
     accacctcag agtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page