(data stored in ACNUC7421 zone)

EMBL: AP011115.PE205

AP011115.PE205       Location/Qualifiers
FT   CDS_pept        179127..179579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48452"
FT                   /db_xref="GOA:C1ASK3"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK3"
FT                   /protein_id="BAH48452.1"
FT                   /translation="MVRRTGRVLPPWYLGPVNKVIVGLHRLGVPMPMPALTVPGRETGV
FT                   LRSTPVSPYEVDGRTYVVAGYAESDWAKNARAAGRGELTRGRRRERVRLVPLPVSERAR
FT                   ILREFPIRVPHGVTMFLKAGTVANSSPEAFAAAADRCEVFRVEPLD"
     atggtgcgcc ggaccgggag agtgttgccg ccgtggtatc tcggccccgt caacaaggtg        60
     atcgtcggcc tgcaccggct gggtgttccg atgccgatgc cggcgctcac cgtcccgggc       120
     cgggagacgg gggtgctgcg gtcgacgccg gtctcgccgt acgaggtgga cggccgcacc       180
     tacgtcgtcg cggggtacgc ggaatcggat tgggcgaaga acgcccgcgc ggccgggcgc       240
     ggcgaactga cccgcggacg tcgccgcgag cgggttcgcc tggtaccgct gccggtgtcg       300
     gagcgcgccc ggatcctccg cgagttcccg atccgggtgc cgcacggggt caccatgttc       360
     ctgaaggccg ggacggtcgc gaactcctct ccggaggcgt tcgcggccgc ggcggaccgg       420
     tgcgaggtgt tccgcgtcga gccgctggac tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page