(data stored in ACNUC7421 zone)

EMBL: AP011115.PE206

AP011115.PE206       Location/Qualifiers
FT   CDS_pept        complement(179586..180002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02060"
FT                   /product="putative copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02060"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48453"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK4"
FT                   /protein_id="BAH48453.1"
FT                   /translation="MKRVPTLVLPILLAILALAACGNDSDDSSASSESEHGGNHMMTDM
FT                   PSMSMPMSMPAGAREIVISDFKYTLPGTFAPGEQVTVRNDDTAEHTVTADTGDLFDVEV
FT                   EPGAVATFTVPGQPGTFAFHCTYHPNMVGTLEVR"
     atgaaacgcg taccgacact tgtcctgccg atcctgctgg ccatcctcgc gctggccgcg        60
     tgcggaaacg acagcgacga ctcgtccgcg tcgtccgagt cggagcacgg cgggaaccac       120
     atgatgaccg acatgccgtc gatgtcgatg ccgatgtcca tgccggcagg tgcacgggag       180
     atcgtgatca gcgacttcaa gtacacgctg cccggaacgt tcgcaccggg agagcaggtc       240
     accgtccgca acgacgacac cgccgaacac accgtgaccg ctgacaccgg cgatctgttc       300
     gacgtcgagg tcgaaccggg cgcggtcgcg acgttcacgg tgcccggcca gccgggcacg       360
     ttcgccttcc actgcaccta ccacccgaac atggtgggca cgctcgaggt tcggtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page