(data stored in ACNUC7421 zone)

EMBL: AP011115.PE207

AP011115.PE207       Location/Qualifiers
FT   CDS_pept        complement(180112..180822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02070"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02070"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48454"
FT                   /db_xref="GOA:C1ASK5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK5"
FT                   /protein_id="BAH48454.1"
FT                   /translation="MPYLERSGDVFVLYFGEEGERDSENAFHPDWIVSVDGLLDRVEQH
FT                   DGPAALVTTAVGKFYSTGLDTAWVLANTDKLNSYIDRVQALFARILTFPLPTVAALTGH
FT                   TFGGGAILAAAHDHRVMREDRGYFCLPGITIGASYAPGSIALLAARLPARAVHTALVTG
FT                   RRYGGVAAKELGFVDEVAPEQQVLADAVAHAQGLVATRGRTLGEIKSSLYADAVVSLRT
FT                   PVANLETQEALNGG"
     atgccgtact tggaacgctc gggtgatgtg ttcgtcctgt acttcgggga ggagggggaa        60
     cgggacagcg agaacgcctt ccatccggac tggatcgtga gtgtcgacgg tctcctcgat       120
     cgggtcgagc agcacgacgg ccccgccgcg ctggtgacca ccgcggtcgg aaagttctac       180
     tccaccggtc tcgacaccgc ctgggtcctc gccaacaccg acaagctgaa ctcctacatc       240
     gaccgggtgc aggccctgtt cgcgcggatc ctcacgttcc cgctgcccac cgtggccgcg       300
     ctgaccgggc acaccttcgg cggcggcgcc atcctcgcgg ccgcccacga ccaccgggtg       360
     atgcgggagg accgcggcta cttctgcctg ccggggatca ccatcggggc gagttacgca       420
     cccggcagca tcgcgctgct cgcggcccgc ctgcccgcgc gggcggtgca caccgccctg       480
     gtgaccggcc ggcggtatgg cggcgtggcg gcgaaggaac tcggattcgt cgacgaggtc       540
     gcccccgagc agcaggtgct cgccgacgcc gtcgcacacg cgcagggact cgtcgcgacg       600
     cgcggccgca cgctcggcga gatcaagtcc tccctctacg cggacgccgt cgtctcgctg       660
     cgcaccccgg tcgcgaacct cgagacgcag gaggcgttga acggcggctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page