(data stored in ACNUC7421 zone)

EMBL: AP011115.PE208

AP011115.PE208       Location/Qualifiers
FT   CDS_pept        180907..181380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02080"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48455"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK6"
FT                   /protein_id="BAH48455.1"
FT                   /translation="MSIVKQLRRWTMKSGTGIADTRTVRDYIHTVARSVHADSIDWWEC
FT                   DGFDAVLVLPFRLHYLPGRNAVLAWNRTFGWSLGVEGLGRRSVIVIDGLGLGRMPSPAG
FT                   CAERAAELIDDYCRSTPALPGPHSAVAPAAADRCPRIGNAAGGGRRDRVVRRP"
     atgtcgatcg tcaaacagct gaggcggtgg acgatgaaga gcggaacagg cattgccgac        60
     acccgcaccg ttcgggacta catccacacg gtggccagga gcgttcacgc cgattccatc       120
     gactggtggg agtgcgacgg attcgacgcc gtcctcgtgc tgccgttccg gttgcactat       180
     ctgcccggtc gcaacgcggt actggcctgg aaccggacct tcggctggtc gctcggcgtc       240
     gaaggactgg gtcgccgcag cgttatcgtg atcgacggcc tcggcctcgg ccggatgccg       300
     tcgccggccg ggtgcgcgga acgtgcggcg gaattgatcg acgactattg ccgttccaca       360
     ccggcactgc cgggcccgca cagtgccgtc gcaccggccg ctgcggatcg ctgtccccgc       420
     atcggcaacg ccgccggcgg cggacggcgg gacagagtcg tccgccgacc gtga             474
//

If you have problems or comments...

PBIL Back to PBIL home page