(data stored in ACNUC7421 zone)

EMBL: AP011115.PE209

AP011115.PE209       Location/Qualifiers
FT   CDS_pept        181377..182543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02090"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48456"
FT                   /db_xref="GOA:C1ASK7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK7"
FT                   /protein_id="BAH48456.1"
FT                   /translation="MTGGAEGHDDNVAQPHSSAQEQPIVAAEQGAARISTAAHPLGRPG
FT                   PRFDRRSPFFIGMAGAAGVAVTYALIEVVLAARGVLVLIAVAAFLAIGLEPAVSWLVRH
FT                   GFPRWAAVATVFVVAFAMLAGFLAAAIPPMVTQGAALVHNAPDYLGHLEQRYPVLQELS
FT                   ARFHLQDELRRALDAGNAPMVLGGIVGAGKFVFSAISGTVIVVVLTAYFLADFGHIRAS
FT                   LYRLAPNSRRPRTILIGDEIFAKVGGYVLGNLLISLITAVLTFVWLVAFDVPYPLLLAV
FT                   LVAVLDLIPVVGSTLAGVVVALVALTVSLPVSLATVVFFIALRLFEDYLLVPRIIGRTV
FT                   KVPPMVTVVAVLIGGALLGIVGALLAIPVAAAVLLLARETVFPQLDRG"
     gtgaccggtg gcgccgaagg ccacgacgac aatgtggccc aaccgcattc ctccgcccag        60
     gagcagccga tcgtcgccgc ggagcagggc gcggcacgga tcagcacggc ggcgcacccg       120
     ctcggcagac ccggtccgcg cttcgaccgc cggtccccgt tcttcatcgg catggccggg       180
     gccgccggtg tcgccgtcac gtacgcgctg atcgaggtcg tcctcgccgc ccgcggggtg       240
     ctggtgctca tcgccgtcgc cgccttcctc gcgatcggtc tcgaaccggc cgtgtcctgg       300
     ctggtgcgtc acggatttcc ccgatgggcc gccgtcgcaa cggtcttcgt ggtcgcgttc       360
     gcgatgctgg ccgggttcct cgccgcggcg atcccgccga tggtgaccca gggcgccgct       420
     ctcgtccaca acgcccccga ctacctgggc cacctcgagc agcgctaccc ggtcctgcag       480
     gaactgagcg cccgcttcca tctgcaggac gaactgcgcc gcgcgctcga cgcgggcaat       540
     gcgccgatgg tgctcggcgg gatcgtcggt gcgggcaagt tcgtgttcag cgccatcagc       600
     ggcacggtga tcgtggtcgt gctcaccgcg tatttcctgg ccgacttcgg gcacatccgg       660
     gcgtccctgt accgcctggc cccgaactcg cggcggccgc gcacgattct gatcggcgac       720
     gagatcttcg cgaaggtcgg cggctacgtg ctcgggaacc tcctgatctc actgatcacc       780
     gcggtcctca ccttcgtgtg gctggtcgcc ttcgacgtcc cctacccact gttgctggcc       840
     gtcctcgtcg ccgtgctgga tctgattccg gtggtcggtt ccaccctcgc tggtgtcgtg       900
     gtagcactgg tcgccctcac cgtctcgctc ccggtgtcgc tggcgaccgt cgtcttcttc       960
     atcgccctcc gcctgttcga ggactatctc ctcgttcccc gcatcatcgg cagaacggtc      1020
     aaggtgcccc cgatggtcac cgtcgtcgcc gtcctcatcg gcggagcact gctggggatc      1080
     gtgggggcgc tgctcgcgat tcccgtcgcc gccgccgttc tgctcctggc ccgcgagacg      1140
     gtgtttccgc agctcgaccg cggttga                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page