(data stored in ACNUC7421 zone)

EMBL: AP011115.PE211

AP011115.PE211       Location/Qualifiers
FT   CDS_pept        complement(184057..185127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02110"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48458"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASK9"
FT                   /protein_id="BAH48458.1"
FT                   /translation="MTTLHSRSASGTAPQAGTSMPCPAPRGPVSGLLFPILRGDTAEAE
FT                   PFVTAALALASAERDDPRAFLFDEDAQICLTALYELHLQGIAGVDDRWEWDSDLIFARS
FT                   ALEVPFDAAIRALADPPTAVGDVVAALWEMTAPSTAPGLSGYMAHDADLSQFRELLIHR
FT                   SLNQLREADVHTLGIPRLAGAPKAALVEVQSDEYGGGRPERMHSALFATTMRELGLSDG
FT                   YAHYVDAVPAVTLASLNALSLFGLHRSRLGALVGHLCAVETTSALPSKKYAAGLRRLGF
FT                   GKAATLFFDEHVEADSVHEQIVCRDLAGGLVAARPAAADDVLLGAAACLAFDDLVGDHV
FT                   TRCWERNRTSLRQPAG"
     atgaccacct tgcactctcg gtcggcgtcg ggcacggcgc cgcaggcggg aacgtccatg        60
     ccctgtccgg ctccgcgcgg tcccgtcagc ggtctcctgt tccccattct gcgcggagac       120
     accgccgagg ccgaaccgtt cgtgacggcg gcgctcgccc tcgcatcggc ggaacgcgac       180
     gacccgcggg cgtttctgtt cgacgaggac gcgcagatct gtctgaccgc actgtacgaa       240
     ctgcacctgc agggcatagc cggggtcgac gaccggtggg agtgggacag cgacctgatc       300
     ttcgcccggt cggcgctgga ggtgccgttc gatgccgcga tccgcgccct cgcggatccg       360
     ccgacggctg tcggcgacgt ggtggcggcg ctgtgggaga tgaccgcccc cagcacggcg       420
     ccgggactgt ccggatacat ggcccacgac gcggatctct cccagttccg ggaactgctg       480
     atccaccgct ccctcaacca gttgcgtgag gcggatgtgc acacgctcgg cattccgcgg       540
     ctcgcgggcg caccgaaggc ggcgctggtg gaggtgcagt ccgacgaata cggcggcggc       600
     cgacccgagc ggatgcactc ggcgttgttc gcgacgacga tgcgcgaact cggactgtcc       660
     gacgggtacg cgcactacgt cgacgcggtg cccgccgtga cgctggcatc gctgaacgcg       720
     ctgtcgctgt tcggcctcca ccgcagccgg ctcggcgccc tggtggggca cctgtgcgcg       780
     gtcgagacca cgtccgcgtt gccgagcaag aagtacgccg ccggactgcg tcgtctcgga       840
     ttcgggaagg cggccaccct gttcttcgac gagcacgtgg aggccgactc cgtgcacgaa       900
     cagatcgtgt gccgggacct cgccggcggg ttggtcgccg cccggcccgc ggcggccgac       960
     gacgtcctgc tgggggccgc ggcgtgcctc gcgttcgacg acctggtcgg cgaccacgtc      1020
     acccgatgct gggagcgtaa tcgcacgtcc ctgcggcaac cggccgggta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page