(data stored in ACNUC7421 zone)

EMBL: AP011115.PE213

AP011115.PE213       Location/Qualifiers
FT   CDS_pept        185567..186022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02130"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48460"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL1"
FT                   /protein_id="BAH48460.1"
FT                   /translation="MKTVLGARPTRRAPAEKPALFSWAVEPEHGRLSVDSAPAADGILV
FT                   VRISGDIDVTTLPSFGSHLEEAIDERLPFVLDLTDVQFFCASALPVLEIMSARAHRLAV
FT                   PWAVTGNNALRRPLTAMNMAAAIPFCTDLEDAFRLVAGGMRQGGRSA"
     atgaagactg ttctcggagc gcgaccgacg cgccgcgccc ccgcagagaa accggcactg        60
     ttcagctggg ccgtcgagcc cgagcacggg cggctctccg tcgacagtgc acccgccgcc       120
     gacgggatcc tcgtcgtccg gatctccggt gacatcgacg tcaccactct cccgtcgttc       180
     gggagtcatc tcgaggaagc gatcgacgaa cggttgccgt tcgttctcga cctcaccgac       240
     gtgcagttct tctgcgcgtc ggccctgccg gttctcgaga tcatgtccgc ccgcgcgcac       300
     cggctcgccg tgccgtgggc ggtgaccggg aacaacgcac tccgcagacc gctgacggcg       360
     atgaacatgg ccgcggccat ccccttctgc accgacctcg aggacgcgtt tcggctggtc       420
     gccggtggaa tgcggcaggg tgggcgctcg gcgtga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page