(data stored in ACNUC7421 zone)

EMBL: AP011115.PE215

AP011115.PE215       Location/Qualifiers
FT   CDS_pept        complement(187482..188252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02150"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48462"
FT                   /db_xref="GOA:C1ASL3"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL3"
FT                   /protein_id="BAH48462.1"
FT                   /translation="MSETAGERPESMSPDLDGGTIAAQLGSLATALDEFNWNSGSQVEM
FT                   GLLLQRVCEQVVDAIADADMAGVSLLRDGLVETVAYADETVRQIDIQSFQAIDGDDYFG
FT                   VAGSRKVVKATRGEAAARWPSLADNLDQAGMRSFLSAPLAVDEALAGTLDIYGRGDHGF
FT                   SELDAVVLLVYTTAIEGLLRSARSVELARNEVTGLTRAMKTRAVIEQAKGIVMALRGVS
FT                   ADRAFEILVAQSQQEHVKLAEVARRIVESVTNPE"
     atgtccgaga ctgcgggtga gcgccctgag tcgatgtccc ctgatctcga cggggggacg        60
     atcgctgccc aactgggctc cctggcaacc gcgttggacg agttcaactg gaactccggc       120
     tcacaggtgg agatgggcct gctgctgcaa cgggtctgcg aacaggtggt ggacgcgatc       180
     gccgacgccg acatggccgg agtgtcgttg ctgcgcgacg gactcgtcga gacggtcgcc       240
     tacgcggacg agacggtccg gcagatcgac attcagagct tccaggccat cgacggcgac       300
     gactacttcg gcgtggcggg cagccggaag gtcgtcaagg cgacgcgcgg ggaagccgcg       360
     gcccggtggc cgtccctggc cgacaacctg gaccaggcgg gaatgcgcag tttcctgtcc       420
     gcgccgctcg cggtggacga ggccctggcc gggaccctcg acatctacgg gcggggcgat       480
     cacggtttca gtgaactcga cgccgtcgtg ctcctcgtct acaccacggc gatcgaagga       540
     ttgctcagga gcgcgcgcag cgtggagttg gccaggaacg aggtgacggg tctcacgcgg       600
     gccatgaaga cccgtgcggt catcgagcag gccaagggga tcgtgatggc actgcggggt       660
     gtgtccgcgg accgggcgtt cgagatcctc gtcgcgcagt cgcagcagga gcacgtgaag       720
     ttggcggagg tggcgcgccg catcgtcgaa tcggtcacga atccggagtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page