(data stored in ACNUC7421 zone)

EMBL: AP011115.PE218

AP011115.PE218       Location/Qualifiers
FT   CDS_pept        complement(189795..190040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02180"
FT                   /product="cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02180"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48465"
FT                   /db_xref="GOA:C1ASL6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL6"
FT                   /protein_id="BAH48465.1"
FT                   /translation="MSAGDTLPARPSTALRTGTVRWFNADQGFGFLAPADGSDDVFVHV
FT                   SEIAGDGHRILVEGQRVSFTVCRTDTGNQARDVRIA"
     atgagcgccg gcgacacact gcctgcccgt ccgtcgaccg ccctgcggac cggcacggtg        60
     cggtggttca acgccgacca gggtttcggg ttcctcgccc cggccgacgg atccgacgac       120
     gtcttcgtcc acgtctccga aatcgccggc gacggtcacc gcatcctcgt ggagggacag       180
     cgcgtcagct tcaccgtctg ccgcaccgac accggcaacc aggcacgcga cgtccggatc       240
     gcctga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page