(data stored in ACNUC7421 zone)

EMBL: AP011115.PE220

AP011115.PE220       Location/Qualifiers
FT   CDS_pept        191096..191332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02200"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48467"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL8"
FT                   /protein_id="BAH48467.1"
FT                   /translation="MAENNSGPAEAVKGVVEDVKGKAKEAAGAVSGQDDLTREGKAQQD
FT                   KAAAQREAAAKEAEAEKARGKAEAQEARQRAEQ"
     atggctgaga acaacagcgg accggcagag gccgtcaagg gcgtcgtcga agacgtcaag        60
     ggcaaggcga aggaagccgc gggcgcggtg tccggccagg acgacctcac ccgcgagggc       120
     aaggcgcagc aggacaaagc cgccgcccag cgcgaggcag ccgcgaagga agccgaagcg       180
     gagaaggccc gcggcaaggc cgaggcacag gaagcacgcc agcgcgccga acagtga          237
//

If you have problems or comments...

PBIL Back to PBIL home page