(data stored in ACNUC7421 zone)

EMBL: AP011115.PE221

AP011115.PE221       Location/Qualifiers
FT   CDS_pept        191379..191642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02210"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02210"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48468"
FT                   /db_xref="GOA:C1ASL9"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASL9"
FT                   /protein_id="BAH48468.1"
FT                   /translation="MLGLGILGWIIIGGLAGWIGSKIMKTDAQMGIVLNIVVGIVGGLL
FT                   GGFILSLFGTDVEGGGLWFSFFTCLLGAVILLFLVKLVTGRR"
     gtgctaggac tgggaattct gggctggatc atcatcggcg gtctcgccgg gtggatcggc        60
     agcaagatca tgaagaccga cgcccagatg gggatcgtcc tcaacatcgt cgtcggaatc       120
     gtcggcggac tactcggcgg tttcatcctc agcctcttcg gcaccgacgt ggaaggcggc       180
     ggtctctggt tcagcttctt cacctgcctc ctcggcgcgg tgatactcct gttcctggtc       240
     aaactcgtga ccgggcgacg ttaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page