(data stored in ACNUC7421 zone)

EMBL: AP011115.PE223

AP011115.PE223       Location/Qualifiers
FT   CDS_pept        192157..192480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02230"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48470"
FT                   /db_xref="GOA:C1ASM1"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM1"
FT                   /protein_id="BAH48470.1"
FT                   /translation="MTYQPDNGPSRELNSEFRPQDDAHTMRNHVGEAITDGRNWPGYIL
FT                   IATGIAVLGLTLVAAGYGFEGWALIGGIACVLCLVLGTVLVLLERRRVKALEGETLTDQ
FT                   EGH"
     gtgacgtatc agccggacaa cgggcccagc cgtgagttga attccgaatt ccgcccacag        60
     gacgacgccc acaccatgcg caatcacgtc ggtgaggcga tcaccgacgg ccggaactgg       120
     cccggctaca tcctgatcgc caccggaatc gccgtgctcg ggttgacctt ggtcgcggcg       180
     ggctacggat tcgagggctg ggcgctgatc ggcggcatcg cctgtgttct gtgcctcgtg       240
     ctcggcaccg tgctggtgct cctcgaacgg cggcgcgtca aagcactcga aggcgagacg       300
     ctgaccgatc aggaagggca ttga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page