(data stored in ACNUC7421 zone)

EMBL: AP011115.PE224

AP011115.PE224       Location/Qualifiers
FT   CDS_pept        192477..193058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02240"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48471"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM2"
FT                   /protein_id="BAH48471.1"
FT                   /translation="MTDPKADLHDYLQAARDALLWKLDGLSEYDIRRPMTATGTNLLGL
FT                   IKHLTGVEIGYFGEPFGRGVDFPPWVTDDAEDNVDMWATADESRDYVVGQYRQAWEHTD
FT                   ATVRALPIDAPGRIRHWPEDRRDVTLHRILVHVIAETHRHAGHADIVRELVDGTAGLRA
FT                   DNDNLPTAERTWWESYRARVERAAREAGQG"
     ttgaccgatc cgaaggcgga cctccacgac tacctgcagg ccgcgcgaga cgctctgctg        60
     tggaagctgg acggattgtc ggagtacgac atccgccgac cgatgaccgc gaccggtacg       120
     aacctgctgg gtctgatcaa acacctgacc ggcgtcgaga tcggctactt cggggagccc       180
     ttcggccgag gcgtcgactt cccaccgtgg gtgacagacg acgccgaaga caacgtggac       240
     atgtgggcga ccgccgacga gtcacgcgac tacgtcgtcg gccagtaccg ccaggcgtgg       300
     gagcacaccg acgccaccgt ccgggcgctg ccgatcgacg cgcccggacg aatacggcac       360
     tggccggaag accgccgcga cgtcacgctg catcggattc tcgtgcacgt gatcgccgaa       420
     actcaccggc atgcggggca cgccgacatc gtccgtgaac tcgtcgacgg aactgccggg       480
     ctgagggcgg acaacgacaa cttgcctaca gccgagcgca cgtggtggga gagctaccgt       540
     gcccgcgtcg aacgggcggc ccgggaagcc ggccagggct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page