(data stored in ACNUC7421 zone)

EMBL: AP011115.PE225

AP011115.PE225       Location/Qualifiers
FT   CDS_pept        complement(193065..194798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02250"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48472"
FT                   /db_xref="GOA:C1ASM3"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM3"
FT                   /protein_id="BAH48472.1"
FT                   /translation="MKRRVSARKVAHRRRIAGSLVAPGALGLAALLATPWSNPGSPATT
FT                   ATALTAAASDACYDMVSIAVAGRGDSPRPGTHQMLVAPDGTPLPASYSSNYTSPWIDEV
FT                   VNAPQQSVGGGSYAAVYIEYPANMNSYEDAVNAGVDNTETVMRSIHASCPDTKFSIVGY
FT                   SEGADVARRVAMEVGNQDGQDGSYDILDPASVVGVVILADAGRNLGEGAFPGAENEFRN
FT                   PDGFDLAYQSGQTSTSGRGALPGTSGSFGALDGKVASFCSEGDLTCSAPENIALLQLAI
FT                   NVGRQLNVDALQKEGLTPATGQDLAVVLGQIALAAFADIQSQDNWMQSDETFLDVLVKV
FT                   SDPAYKPADPVAAQSDTPTGPISSNQAVDLVYLPTKVRNEIIGFIADNQNTIQVAMSDP
FT                   YQQTLGEGTGHHFDYWRDANAGNGRPLTSAQYAAAWLTHLAQEAEKGEARSAASQQATA
FT                   KLAAASTPDTEAAQVAPTTTAGAKKPALASDAVSATTTTTGSPAPTTVASTTSPEPTTA
FT                   EPTTAVEVATPNTTSPPAAQAVSESSAVATTTAEPAASTATESATTTPVVTTTTVQPAA
FT                   G"
     atgaaacgtc gcgtgtcagc acgcaaggtc gcgcatcgac ggagaatcgc aggcagcctg        60
     gtcgcccccg gcgcgctggg actcgcggcg ctgctcgcga caccgtggtc gaaccctggt       120
     tcgccggcca cgacggcgac agccttgacc gcagcggcct cggacgcgtg ctacgacatg       180
     gtcagcatcg cagtggccgg ccgcggcgac agcccgaggc cgggcaccca ccagatgctc       240
     gtggcaccgg acggcacgcc ccttcccgcg tcgtactcca gcaactacac cagtccctgg       300
     atcgatgagg tggtgaacgc cccgcagcaa tccgtcggcg gagggtccta cgccgcggtc       360
     tacatcgagt atccggcgaa catgaactcg tacgaggacg ccgtgaacgc cggtgtcgac       420
     aacaccgaaa ccgtcatgcg ctccattcac gcgtcgtgcc cggacacgaa gttctcgatc       480
     gtcggctaca gcgaaggcgc cgatgtcgcg agacgcgttg cgatggaggt cgggaaccag       540
     gacggccagg acggctcgta cgacattctc gatcccgcgt ccgttgtcgg tgtcgtcatc       600
     ctggcggacg ccggacgcaa cctcggcgaa ggagcatttc cgggcgccga gaacgaattc       660
     cgcaatccgg acggtttcga tctggcctac cagtcgggtc agaccagcac gtccgggagg       720
     ggcgctctgc ccggcacgtc cggcagtttc ggcgcgctgg acgggaaggt ggcgtcgttc       780
     tgctcggaag gcgatctcac ctgctccgct ccggagaaca ttgcgttgct gcaactcgcg       840
     atcaacgtgg gacggcagtt gaacgtcgac gcattgcaga aggaaggcct gaccccggcg       900
     acagggcagg atctcgcggt ggtgctcggg cagatcgctc tcgccgcgtt cgcggacatt       960
     cagtcgcagg acaattggat gcagtccgac gagacgttcc tcgacgtctt ggtcaaggtg      1020
     tcggatccgg cgtacaagcc cgccgatccc gttgcggcgc agtccgacac gccgaccggt      1080
     ccgatctcgt ccaaccaggc ggtggacctc gtctacctgc ccaccaaggt gcggaacgaa      1140
     atcatcgggt tcatcgcgga caaccagaac acgatccagg tggcgatgag cgatccgtac      1200
     cagcagacgc tgggggaggg gaccggacac cacttcgact actggcgtga cgcgaacgcc      1260
     ggaaatggga gaccgctgac gtctgcccag tatgcagcgg cctggctgac gcacctcgcg      1320
     caggaagcgg agaagggcga ggcgcgctcg gccgcgtcgc agcaagcgac tgcgaaactc      1380
     gccgccgcct cgacaccgga cacggaagcg gcgcaggtcg cacccaccac tacggccggc      1440
     gctaagaagc ccgcgctggc gagcgacgcg gtcagtgcaa ccacgacgac gaccggttca      1500
     ccggcgccca cgacggtcgc gtccacgact tcgcccgaac cgacgaccgc cgaaccgacg      1560
     acagccgtgg aggtggcgac gcccaacacg acgtcgccgc ctgcggcgca ggccgtttcg      1620
     gaatcgtccg cggtggcgac caccaccgcc gaacccgcgg cgagcacggc aacggagtcg      1680
     gcgaccacca cgccggtagt caccacgacg acggtgcagc cggcggccgg gtga            1734
//

If you have problems or comments...

PBIL Back to PBIL home page