(data stored in ACNUC7421 zone)

EMBL: AP011115.PE226

AP011115.PE226       Location/Qualifiers
FT   CDS_pept        195299..196024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48473"
FT                   /db_xref="GOA:C1ASM4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM4"
FT                   /protein_id="BAH48473.1"
FT                   /translation="MSNDPSEAAHVGRDSPSAVFAKLAEMVYNGDDFDHVYQAICDAAA
FT                   TLVPGCAHASLMLKQKDRHITVAASDEVAAHVDALERAEQEGPCLDAIENDAPQVEAEL
FT                   ARSTQWPRLARRAIAETPVRGAAGFRLLIHGRKVGALNLFADNPGEFTDESIDQAILIT
FT                   AFAAVTLTALHEHQEAQTLRDGLASNREIGKAIGLLMAFHDISEDRAFELLRKTSQDMN
FT                   IKLTSVAREVIVHHNSKFD"
     atgtcgaatg atccttcgga ggcggcacat gtgggacgcg acagtcccag cgccgtcttc        60
     gcgaagctgg cggagatggt gtacaacggc gacgacttcg atcacgtcta ccaggccatc       120
     tgcgatgccg cggcaactct ggttcccggg tgcgcgcatg ccagcctcat gctgaagcag       180
     aaggatcgcc acatcaccgt cgcggcgagc gacgaggtcg cagcgcacgt cgatgcgctc       240
     gagcgagccg agcaggaagg cccctgcctc gacgcgatcg agaacgacgc accgcaggtg       300
     gaggccgaac tcgcgcgttc gacgcagtgg ccgcgcctcg cccggcgcgc gattgccgag       360
     acgcccgtcc ggggcgcggc tgggttccgg cttctgattc acggacgcaa ggtcggcgca       420
     ctcaacctgt tcgcggacaa ccccggagag ttcaccgacg aatcgatcga tcaggcgatc       480
     ctgatcacgg cgttcgcggc ggtgaccctg acagcgctcc acgaacacca ggaagcgcag       540
     actcttcgcg acggcctcgc cagcaaccgt gagatcggga aagccatcgg gctgttgatg       600
     gcattccacg acatctccga ggatcgggct ttcgaactgc tgcgcaagac gtcgcaggac       660
     atgaacatca agctcaccag cgtcgcacgg gaagtaatcg tgcaccacaa ttcgaaattc       720
     gactga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page