(data stored in ACNUC7421 zone)

EMBL: AP011115.PE23

AP011115.PE23        Location/Qualifiers
FT   CDS_pept        complement(20157..20417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00230"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48270"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS21"
FT                   /protein_id="BAH48270.1"
FT                   /translation="MPHAAVRDCARRMMIVQLKYATARSGSDAALAHSDVSAAVGTPGT
FT                   FHEPSMVFFEENLRPGGTNGYTTSWGTNAHGKLAGCPPSAH"
     atgccgcacg ccgcggtacg ggactgcgcc cgtagaatga tgatcgtgca gctcaagtat        60
     gcgaccgccc ggagcgggtc ggatgctgcg ctcgcgcact cggatgtgtc ggcggccgtg       120
     ggcaccccgg gcacgttcca cgagccgtcg atggtgttct tcgaggagaa cctgcgcccg       180
     ggcggcacca acggatacac cacctcgtgg ggaacgaacg cgcacggcaa actcgccggc       240
     tgcccaccct cagctcactg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page