(data stored in ACNUC7421 zone)

EMBL: AP011115.PE230

AP011115.PE230       Location/Qualifiers
FT   CDS_pept        complement(198083..199066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02300"
FT                   /product="putative metal ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02300"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48477"
FT                   /db_xref="GOA:C1ASM8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM8"
FT                   /protein_id="BAH48477.1"
FT                   /translation="MDVRFVSDDGVRSCAATELKELLDRPDGLVWVDIPTWDDQAHDTL
FT                   TTVFDCHPLAVRDSKNRNQVPKVHRYVDQLFVVLHAPQSGAHGHVHYVELDQFIGARYL
FT                   VTVHGPVNPAIDPSTAMVEVNVVLSRLESGKLRPGTAFELSFALLAALTARMRAYTAEL
FT                   TKDVWKLEQQVTGGHLGDPETFLDEMFRVRHGLLTVGTMAALSGEVYGRMVTIEAFGAG
FT                   KGQDLLLDAVDQFQHLTVMARGQKDYLQGTIEFYQARTNTKMTIAAERLAVIAAVTLPI
FT                   TALSSIIGMNVIVNERTQWPAVAVIVLVMLAMSGALLVWAKRKGWF"
     atggacgtcc gcttcgtctc cgacgacggt gtgcgctcgt gcgcggcgac cgaactgaaa        60
     gagttgctcg accggcccga cggattggtc tgggtggaca tcccgacctg ggacgatcaa       120
     gcacacgaca cgttgacgac tgttttcgat tgtcatcctc tcgccgtccg ggattcgaag       180
     aaccgcaatc aggtgccgaa ggtgcaccgg tacgtggacc aactcttcgt ggttctgcac       240
     gcgccgcagt cgggagcaca cgggcacgtg cactatgtcg aactggacca gttcatcggt       300
     gcccgctacc tggtcacagt gcacggcccc gtgaacccgg cgatcgatcc ctcgacggcg       360
     atggtcgagg tgaatgtggt gctgagccga ctggagtcgg gcaagttgcg gcccggcacg       420
     gcattcgagt tgtcgttcgc gctcctggcc gcgctgacgg cgcggatgcg ggcctacacc       480
     gccgaactga ccaaggacgt gtggaagctc gagcaacagg tcaccggcgg gcacctcggt       540
     gatccggaaa cattcctcga cgagatgttc cgggtccggc acggtctgct cacagtcggc       600
     accatggccg cgttgagcgg ggaggtgtac ggcaggatgg tcaccatcga ggcattcggg       660
     gcaggcaagg gacaggacct cctactcgac gcggtcgacc aattccagca cctgacggtg       720
     atggccaggg gacagaagga ttacctgcag ggcacgatcg agttctacca ggcgcgcacg       780
     aacaccaaga tgaccatcgc cgcggaacgc ctcgccgtca tcgcggctgt cacgctgccg       840
     atcaccgccc tgtcctcgat catcgggatg aacgtgattg tgaacgaacg gacgcagtgg       900
     cccgcggtag ccgtgatcgt gctcgtcatg ctcgccatgt ccggggcact gctcgtctgg       960
     gcgaagcgca aaggctggtt ctga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page