(data stored in ACNUC7421 zone)

EMBL: AP011115.PE231

AP011115.PE231       Location/Qualifiers
FT   CDS_pept        199173..199586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02310"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48478"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASM9"
FT                   /protein_id="BAH48478.1"
FT                   /translation="MADNRTGLIVVDAANVVGSRPDGWWRDRAGAARRLLVQLDALEQH
FT                   LDQPAEVVVVIEGAAKAAVAGDPNRELNGLRVVSAHGSGDDAIVDVVAAEKDGERQITV
FT                   VTADRGLRARVEALGAVTVGPRWLFARIDAASS"
     atggccgaca acaggactgg actgatcgtg gtggacgcgg cgaacgtcgt cggctcgcgg        60
     cccgacggtt ggtggcgtga tcgggccggt gcagcccggc gattgctcgt ccaactggac       120
     gccctggaac agcatctgga ccagcccgcc gaggtggtgg tcgtgatcga gggtgcggcg       180
     aaggccgcgg ttgccgggga cccgaatcgg gaattgaacg gcctgcgggt ggtgtcggcg       240
     cacggttcgg gcgacgacgc gatcgtcgac gtcgtggccg ctgagaagga cggcgaacgg       300
     cagatcacgg tcgtcaccgc agaccgtggg ctccgggcgc gcgtcgaggc gctcggagcc       360
     gtcacggtcg gtccgcggtg gctctttgcg cgcatcgacg ccgcgagttc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page