(data stored in ACNUC7421 zone)

EMBL: AP011115.PE235

AP011115.PE235       Location/Qualifiers
FT   CDS_pept        complement(202459..202680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02350"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48482"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN3"
FT                   /protein_id="BAH48482.1"
FT                   /translation="MMSDSKKEFVALRLDEVIHEWEANAPAGGSGSEGPLVTAQRHRAE
FT                   IDSASDDRVDEIAEAYPEIAQAWSSRGA"
     atgatgagtg acagcaagaa ggaattcgtg gccctccgcc tcgacgaggt gatccacgaa        60
     tgggaggcga acgcacccgc cggcggttcg ggatcggagg ggccgctggt cacagcgcag       120
     cggcatcggg ccgagatcga cagcgcgagc gacgaccggg tcgacgagat cgctgaggcg       180
     tatcccgaga tcgcgcaggc gtggtcctcg cgcggcgcct ag                          222
//

If you have problems or comments...

PBIL Back to PBIL home page