(data stored in ACNUC7421 zone)

EMBL: AP011115.PE237

AP011115.PE237       Location/Qualifiers
FT   CDS_pept        204160..204429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02370"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48484"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN5"
FT                   /protein_id="BAH48484.1"
FT                   /translation="MSAASKAMYKPLALAASVAGGIAASAVFGQVWKRLAGESEVPDPK
FT                   DLSRSTREVLIAAAVQGTVFGLVKAAVDRAGAQGYRKLAHADPR"
     atgagcgcgg catcgaaggc gatgtacaaa ccgttggcgc tggctgcgag tgtcgccggt        60
     ggaatagcgg cgagcgccgt gttcggtcag gtgtggaagc ggctcgcagg cgaatccgag       120
     gttcccgacc cgaaggatct gtcccgaagc acccgcgaag tgctgatcgc ggccgccgtg       180
     cagggcaccg tcttcggcct ggtcaaggcg gcggtcgacc gggcaggtgc gcagggctac       240
     cggaaactcg cccacgccga cccccggtag                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page