(data stored in ACNUC7421 zone)

EMBL: AP011115.PE238

AP011115.PE238       Location/Qualifiers
FT   CDS_pept        204469..205116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02380"
FT                   /product="PhoU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02380"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48485"
FT                   /db_xref="GOA:C1ASN6"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASN6"
FT                   /protein_id="BAH48485.1"
FT                   /translation="MRTRFAENLDSLSGDLASMCRLSVTAMSEASDALLEADLGLAEHV
FT                   IDASGELDDAAAHWEKRAFALLALQAPVAHDLRFMVGGLHISADLHRMGGLAVHIAKIA
FT                   RRRHPEHVVPDEVRDVFTEMGSVAVAQARETEQVLQHRDPERARGLLTADEAMDDLHRS
FT                   LFTITQAEDWPHGVQSAVDITLLGRFYERFCDHTVEIGRRVIFLETGSLPEQ"
     atgcgtactc gtttcgcgga aaatctcgac agcctgtccg gcgatctcgc ctcgatgtgc        60
     cggttgtcgg ttaccgcgat gtcggaggca agcgacgcac tgctggaggc agacctcggg       120
     ctcgccgagc acgtcatcga cgcgagcggc gagctcgacg atgcagcggc gcactgggag       180
     aaacgtgcgt tcgcgctgct cgccctgcag gcgccggtcg cacacgacct ccggttcatg       240
     gtcggcggcc tccatatctc cgcagatctg cacaggatgg gcggtctcgc ggtgcacatc       300
     gcaaagatcg cccgccggcg gcatcccgag cacgtcgtcc ccgacgaggt gcgggacgtg       360
     ttcaccgaga tgggttcggt cgccgtcgcg caggcgaggg agaccgagca ggtgctgcag       420
     caccgcgacc ccgagcgcgc ccgcgggtta ctgacggcgg acgaggcgat ggacgacctc       480
     catcgcagcc tgttcacgat cacccaggcc gaggactggc cgcacggtgt ccagtcggcc       540
     gtcgacatca ccctgctcgg ccgcttctac gagcggttct gcgaccacac ggtagaaatc       600
     gggaggcgtg tcatcttcct ggagaccggc agcctgcccg agcagtga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page