(data stored in ACNUC7421 zone)

EMBL: AP011115.PE244

AP011115.PE244       Location/Qualifiers
FT   CDS_pept        complement(210421..211026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02440"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48491"
FT                   /db_xref="GOA:C1ASP2"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP2"
FT                   /protein_id="BAH48491.1"
FT                   /translation="MRSAHGCGDRSFENSGLDMSDGSVERDQDDEWNYRARHETETQRL
FT                   DRNWAALLQELRVVQTGVQLLTGFLLTLPFQQRFTDLTDFEVIVYLMTVALSVLSTMLL
FT                   VAPAGFHRVLFRRHALPALVSAAHKLTVCGIATFGAALVGVVLLIFSFVVSPRVGLVAA
FT                   VVAAGIFCGLSVLAAILRLRNRVDDDPPTSDQRRSDRD"
     atgcgctcgg ctcacggttg cggtgaccga tcctttgaga acagcgggct ggacatgtcg        60
     gacggcagtg ttgagcggga tcaggacgac gagtggaact atcgcgcccg gcacgagacg       120
     gaaacccagc ggctcgaccg caactgggca gcgctgttac aggaactccg cgttgtgcag       180
     accggggtgc agctgctcac cggcttcctg ctgacgttgc cgttccagca gcggttcacc       240
     gatctgacgg acttcgaggt gatcgtctac ctcatgacgg tcgctctgtc ggtcctgtcg       300
     acgatgctgc tggtcgcgcc ggccggattc caccgggtgc tgttccgtcg gcatgccctt       360
     cccgcgctgg tgtccgcggc gcacaagttg acggtgtgtg gtatcgcgac gttcggggcg       420
     gccctcgtcg gggttgtgct tctcatcttc agtttcgtag tgtcgccgag ggtcggtctc       480
     gtcgcggcag tggttgccgc aggaatcttc tgcgggctgt ccgtccttgc cgcgatcctg       540
     cgtctccgga accgcgtcga cgatgatcct cccacgagtg accagcgccg atccgatcgc       600
     gactga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page