(data stored in ACNUC7421 zone)

EMBL: AP011115.PE245

AP011115.PE245       Location/Qualifiers
FT   CDS_pept        211185..211454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02450"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48492"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASP3"
FT                   /protein_id="BAH48492.1"
FT                   /translation="MRSSQRARTKLTRVDTGEHHLFMNSAEEARQILQVTTRLITKFPA
FT                   VPRESVEAAVQDAVVQFEGGRIRDFVPLLIERTATANLVSSVNA"
     atgcgttcgt cacagagagc ccgcacgaaa ttgacgcggg ttgacacagg cgagcaccat        60
     ttgttcatga attccgcgga agaagcccgc cagatcttgc aggtcaccac gcgactgatc       120
     acaaagttcc cggcggtgcc gcgagagtcg gtcgaggccg ccgttcagga cgcggtcgtc       180
     cagttcgaag gcgggcggat tcgggacttc gtgccgttgc tcatcgagcg cacggcaacc       240
     gcgaacctcg tctcctcggt caacgcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page