(data stored in ACNUC7421 zone)

EMBL: AP011115.PE247

AP011115.PE247       Location/Qualifiers
FT   CDS_pept        complement(212114..212887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02470"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48494"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR17"
FT                   /protein_id="BAH48494.1"
FT                   /translation="MGNGTRFRDTPVAARGTPEEVWQSWLGSVHCPPIPLKDCDRMVVV
FT                   APHPDDEVLGVGALMATTATAGVPVQVVAVTDGGASHPQSPTLPPAALAAARIAESNRA
FT                   TALLGVGEPLRFGLPDGGVSAHEHELTTRLVDVLTATCRAGERVWVLATWRGDGHPDHE
FT                   ATGRAAAEACSITGHRMVEYPVWMWHWARPGEASVPWNRIRVLAPTADILARKRRAVDE
FT                   FRTQILPLSDDPRDAAILPPWVLARLMRPTERVLW"
     gtgggcaacg gcaccaggtt ccgggacaca cccgtggccg cgcggggcac cccggaggag        60
     gtgtggcagt cgtggctggg ctccgtccac tgtccgccga taccgctcaa ggactgcgac       120
     cgcatggtcg tcgttgcccc gcatcccgac gacgaggttc tcggcgtggg agcgttgatg       180
     gcgaccacgg caaccgccgg tgtgcccgtc caggtcgtgg ccgtcaccga cggcggcgcg       240
     tcacatccgc agtcgccgac cctgccgccc gccgcgctgg cggcggcgcg gatcgccgaa       300
     tcgaaccggg cgacagcgct gttgggcgtc ggcgaaccac tccgattcgg actgccggac       360
     ggcggggtca gcgcgcacga acacgagctc accacccgcc tcgtcgacgt cctcaccgcg       420
     acctgccggg cgggggagag ggtgtgggtc ctcgcgacct ggcggggcga cggccatccc       480
     gatcacgaag ccaccggaag ggctgcggca gaagcctgtt cgattaccgg acaccgaatg       540
     gtggagtacc cggtctggat gtggcactgg gcgcgtccgg gcgaagcgtc ggtcccctgg       600
     aaccggatcc gtgtgctggc accgacggcc gacatcctgg cgcgcaaacg tcgggccgtc       660
     gacgaattcc gcacccagat cctgccgttg tccgacgacc cgcgggacgc cgcgatcctc       720
     ccaccgtggg ttctggctcg actgatgcgc ccgacggaac gggtgctgtg gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page