(data stored in ACNUC7421 zone)

EMBL: AP011115.PE248

AP011115.PE248       Location/Qualifiers
FT   CDS_pept        complement(212890..213855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02480"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48495"
FT                   /db_xref="GOA:C1AR18"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR18"
FT                   /protein_id="BAH48495.1"
FT                   /translation="MSTDVTHDSTPTSAAVRAIIRSGEAELPLPGDGSTAVRWGRLTEW
FT                   CRRDLSIGRLLEAHADADAILAEIDGTRAGRNEWWGVWASEPPQPVLDAAHDSSGWRLR
FT                   GTKAWCSGASMCTHALITARVDGRPRLFAVDLREPGVTPGRGGWRNPGMAATDTEAVTF
FT                   DSVPARPVGSADRYLDRAGFWHGGIGVAACWFGGALAVAEPLRVRARGGRADSHQLAHL
FT                   GAIDVAVSAARWALASAAAEVDSDPLDRRSAQVRAFRVRGLVERTASEVIDRVGRALGA
FT                   APLASDADHASTVADLLVYIRQSHAERDLATLGELVAGED"
     atgagcaccg acgtcaccca cgacagcacc cccacatccg ccgccgtgcg agcgatcatc        60
     cgctcgggcg aggcggaact gccgctgccc ggcgacggtt ccaccgcggt ccgctggggg       120
     cgactgaccg aatggtgccg ccgcgacctc tcgatcggcc ggctgctcga ggcacacgcg       180
     gacgcggacg cgatcctcgc cgagatcgac ggcacccgcg ccggccggaa cgagtggtgg       240
     ggagtctggg ccagcgagcc accacagccc gtcctggacg ctgcccacga ctcgagcgga       300
     tggcgcctga ggggaacgaa ggcgtggtgc tccggggcgt cgatgtgcac gcacgccctg       360
     atcacggcac gcgtcgacgg ccgaccccgg ctgttcgccg tcgatctgcg ggaacccggg       420
     gtcacgccgg gacgcggggg ctggcgcaat ccggggatgg cggcgaccga cacggaggcg       480
     gtgacattcg acagtgttcc cgcgcgaccc gtcggctccg cggaccggta cctcgatcga       540
     gcggggttct ggcacggcgg catcggggtg gcggcgtgct ggttcggtgg cgcgctcgcc       600
     gtcgcggaac cgctgcgggt tcgtgcccgc ggtggccggg cggacagtca ccagctcgcg       660
     cacctcggcg cgatcgacgt cgccgtcagc gcggctcgat gggcactcgc ctccgcagcc       720
     gcggaggtgg actcggatcc cctcgaccgg cggtccgccc aggtgcgcgc gttccgggtg       780
     cggggcctcg tcgagcgcac cgcgagcgag gtgatcgacc gcgtcgggcg cgcgctgggc       840
     gccgcgccgc tcgcgagcga cgcagaccac gccagcaccg tcgcggacct gctcgtctac       900
     atccggcaat cccatgccga gcgcgatctg gcgacactcg gcgaactcgt cgcaggggag       960
     gactga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page