(data stored in ACNUC7421 zone)

EMBL: AP011115.PE250

AP011115.PE250       Location/Qualifiers
FT   CDS_pept        214631..215158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02500"
FT                   /product="oxidoreductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02500"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48497"
FT                   /db_xref="GOA:C1AR20"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR20"
FT                   /protein_id="BAH48497.1"
FT                   /translation="MNAADSPRYRKIVLTVDGEERTLDVDTRTTLLDALRDHLGVTAPK
FT                   KGCDHGQCGSCTVLLDGRRATSCLTFAVAHDGARVVTAHGLADGDVLHSVQQAFVEQDG
FT                   LQCGYCTPGQICSAIGMFDEFLALQPSAVTENLTAPPELTDDEIRERMSGNLCRCGAYP
FT                   NILAAIRQAAEA"
     atgaatgccg cggacagccc ccgctaccgg aagatcgtgc tcaccgtgga cggcgaggaa        60
     cggaccctcg acgtggacac ccgcaccacc ctgctcgacg cgctccgcga ccacctcggg       120
     gtgaccgcgc cgaagaaggg ctgcgaccac ggccagtgcg gttcgtgcac cgttctcctc       180
     gacggcaggc gcgccacgtc ctgcctgacg ttcgccgtcg cccacgacgg tgcccgcgtc       240
     gtcaccgcac acggcctggc cgacggcgac gtgctgcatt ccgtccagca ggcgttcgtc       300
     gagcaggacg ggctgcagtg cggctactgc acgcccggcc agatctgctc ggcgatcggg       360
     atgttcgacg agttcctcgc cctgcagccg agcgccgtca ccgagaatct cacggctcct       420
     cccgaactca ccgacgacga gatccgggaa cggatgagcg gaaacctctg ccggtgcggc       480
     gcctacccga acatcctcgc ggcgatccgg caggcggcgg aggcatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page