(data stored in ACNUC7421 zone)

EMBL: AP011115.PE251

AP011115.PE251       Location/Qualifiers
FT   CDS_pept        215155..216147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02510"
FT                   /product="oxidoreductase FAD-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02510"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48498"
FT                   /db_xref="GOA:C1AR21"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR21"
FT                   /protein_id="BAH48498.1"
FT                   /translation="MIPFDYERASDVDSAVATVTADPGASYLAGGTNLVDHMKLGVARP
FT                   HLLVDVSRLPLDDVEALPGGGLRIGAAVRNSDLAAHEVVRARYPMLSRALLSGASGQLR
FT                   NLATTAGNLLQRTRCVYFQDVTTPCNKREPGTGCSALGGYVRYHAILGASEHCVAVHPS
FT                   DMAVAMTALDAVVVVRTADGERRIPLREFYVLPGDRPDRDTVLGHGDLVTAVELPAPPA
FT                   GNRSTYRKVRDRASFAFAVTSVAAELTVDDRSITSARVALGGVAHRPWRATRAEEVLLG
FT                   SPPTENTFTAAAEAELAAAQPLPGTEFKVVLTRRVLVSVLRSLAEEARR"
     atgattccct tcgactacga gcgggccagc gacgtggaca gcgccgtcgc caccgtcacg        60
     gccgatcccg gggcgtcgta cctcgccggt ggcaccaacc tcgtcgacca catgaaactc       120
     ggggtggcgc ggccgcatct cctcgtcgat gtgagccgtc tccccctcga cgacgtcgag       180
     gcacttcccg gcggcggact ccggattggg gccgccgtcc gtaacagcga cctcgccgcg       240
     cacgaggtgg tgagagcccg gtacccgatg ctgtcgcgcg cgctgctgtc cggtgcgtcg       300
     ggacagctgc gcaatctcgc gacgaccgcg ggaaacctgc ttcagcggac ccgctgtgtg       360
     tacttccagg acgtcacgac gccgtgcaac aaacgcgagc ccggcaccgg ctgttccgcg       420
     ctgggtggtt acgtccgcta ccacgccatt ctcggcgcct cggagcactg cgtcgccgtg       480
     catccgtccg acatggcggt cgcgatgacg gccctcgacg cggttgtggt ggtgcgcacg       540
     gccgacgggg agcggcggat cccgctccgc gagttctacg tccttcccgg agaccggccc       600
     gaccgcgaca ccgtcctcgg gcacggcgac ctcgtgaccg ccgtggaatt gccggcgccg       660
     cccgccggaa accggtcgac gtaccggaag gtgcgggacc gggcgtcctt cgcgttcgcg       720
     gtgacgtcgg tggccgccga gctgaccgtc gacgacaggt cgatcacgtc ggcgcgggtg       780
     gcgctcggtg gtgtcgcgca ccggccgtgg cgcgccacgc gcgccgagga ggtcctgctc       840
     gggtcgccgc ccacggagaa tacgttcacc gcggcggctg aggcggaact cgctgccgcg       900
     cagccgcttc cgggtaccga gttcaaggtc gtgctgaccc ggcgggtcct ggtgtcggta       960
     ctccggtcac tcgcggagga ggcacgccga tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page