(data stored in ACNUC7421 zone)

EMBL: AP011115.PE252

AP011115.PE252       Location/Qualifiers
FT   CDS_pept        216144..218240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02520"
FT                   /product="oxidoreductase molybdopterin-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02520"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48499"
FT                   /db_xref="GOA:C1AR22"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR22"
FT                   /protein_id="BAH48499.1"
FT                   /translation="MTLVEPKVIGTPAERLDAHDKVTGTASYAFEHTVDDPAHLYPIPS
FT                   TIGRGRVTAVHTTDAEALDGVLAVLTVFDAPRLADTSDGELAILQDPEVHFRGQFVGAV
FT                   VAESPEVARHAAGLVRVDYDEASHDTDFRSGRDDLYAPDEVNAGFPTDTDDGDVDAALA
FT                   GSTVTVDQVYSTAMEHNNPMEPHATIAQWTPGGSGPVLTLHDSTQGVHSVRKTLAPLFG
FT                   LEVEQVRVIAPYVGGGFGSKGLPHAHNVLVVLAAQRVAGRPVKFALTRQQMFALSAYRA
FT                   PTVQRVRLGADADGRLTALSHEVITQSAKIKEFAEQAAVSSRMMYSAPTRRTTHRLAAL
FT                   DVPAPSWMRAPGETPGMFAAEVALDELAAACRLDPIELRIRNEPEVDPSTGRPWSGRRL
FT                   TDCLREGARRFGWADRDATARSRSDSEWQVGLGVAAATYPANTMPGSVARIVYQSDGTY
FT                   TVQIGSVDIGTGAWTALTQIAADALGCPLDSIVLQIGDTNLPPATVAGGSTGTTSWGSA
FT                   IVAAARAFRAEHGTNPSPGAEAAAGTLDNPDAAEFALHSFGAHFVEAHVRRDSCEIRVE
FT                   RMLGVFAIGRVVNARTVRSQLIGGMTMGVSMALHESSVNDPRFGHVVTQDLASYHVSTH
FT                   ADIGYLDAVCLDDVDEHAGPMGSKGAGEIGIVGAAAAVANAVHHATGVRVRKVPIHLDD
FT                   LLPG"
     atgacgctcg tcgagccgaa ggtgatcgga acccccgccg agcgcctcga tgcccacgac        60
     aaggtgaccg ggacggcgtc atacgcgttc gagcacacgg tggacgaccc ggcgcatctg       120
     tacccgatcc cctcgacgat cggacgcggc cgggtcaccg ccgtgcacac gacggacgcg       180
     gaggccctgg acggggtgct cgcggtcctg acggtcttcg atgcgccccg tctcgcggac       240
     acctcggacg gggaactcgc gatcctgcag gaccccgagg tccacttccg cggtcaattc       300
     gtgggtgcgg tggtcgcgga atcaccggag gtcgcccggc acgcggcggg cctcgtccgg       360
     gtcgactacg acgaggcgtc ccacgacacc gacttccgtt ccggccgaga cgatctgtac       420
     gccccggacg aagtcaacgc cggcttcccg accgacaccg acgacggcga cgtggacgcc       480
     gcactggccg gttctaccgt cacggtcgat caggtgtact cgaccgcgat ggaacacaac       540
     aatccgatgg agccgcacgc caccatcgcc cagtggacac cgggcggcag cggaccggtt       600
     ctgacgctgc acgattcgac gcagggcgtc cattccgtgc ggaagaccct ggcaccgctg       660
     ttcggactcg aggtggagca ggtgcgggtg atcgccccgt acgtcggcgg cggattcggg       720
     tccaagggac tgccgcacgc gcacaacgtg ctcgtggtgc tggcggcgca gcgggtggcc       780
     ggacggccgg tgaaattcgc gctgacccgg cagcagatgt tcgcgctgtc cgcctaccgg       840
     gcgccgaccg tgcagcgcgt ccggctcggc gcggacgccg acggacggtt gaccgcgctc       900
     tcccacgagg tgatcaccca gtccgcgaag atcaaggaat tcgccgaaca ggcggcggtt       960
     tcgtcgcgga tgatgtactc cgcacccacc cggcgcacca cccaccggct ggcggcgctc      1020
     gacgtgcccg ctccgtcgtg gatgcgtgcg cccggtgaga cgccggggat gttcgcggcg      1080
     gaggtggcgt tggacgagct ggccgcggcg tgccggctcg accctatcga gctgcggatc      1140
     cgcaacgaac ccgaggtcga cccgagtacg ggccgcccgt ggtcggggcg gcgcctcacc      1200
     gactgcctgc gggagggcgc ccggcgtttc gggtgggcgg accgcgatgc gacggcgcgg      1260
     tcgcggtcgg actcggagtg gcaggtgggg ttgggcgtcg ccgccgcgac gtaccccgcg      1320
     aacaccatgc cgggatcggt cgcccggatc gtgtaccagt ccgacggcac gtacaccgtg      1380
     cagatcggct cggtggacat cggcaccggt gcgtggacgg cgctcaccca gatcgccgcc      1440
     gacgcgctcg ggtgcccgct ggactcgatc gtcctgcaga tcggagacac gaaccttccg      1500
     ccggcgacgg tcgccggggg ctccacggga accacgtcct ggggcagcgc gatcgtcgcg      1560
     gcggcccgcg cgttccgggc cgagcacggc acgaacccgt ccccgggggc ggaggccgct      1620
     gcggggaccc tcgacaatcc cgacgccgcc gagttcgcgc tccattcgtt cggcgcccac      1680
     ttcgtggagg cgcacgtccg ccgcgactcc tgcgagatcc gagtcgaacg catgctcggc      1740
     gtgttcgcga tcggccgggt ggtcaacgcc cggacggtgc ggtcgcagct catcggcggc      1800
     atgacgatgg gggtgtcgat ggcgttgcac gagagcagcg tgaacgaccc ccggttcggc      1860
     cacgtcgtga cgcaggacct ggcctcgtat cacgtcagca cgcacgccga catcgggtat      1920
     ctggacgcgg tctgcctcga cgacgtcgac gagcacgccg gcccgatggg gtcgaagggt      1980
     gccggcgaga tcggcatcgt cggcgccgcg gccgcggtgg cgaacgcggt gcatcacgcc      2040
     accggggtcc gggtgcggaa ggtcccgatc cacctggacg atctgctgcc ggggtga         2097
//

If you have problems or comments...

PBIL Back to PBIL home page