(data stored in ACNUC7421 zone)

EMBL: AP011115.PE253

AP011115.PE253       Location/Qualifiers
FT   CDS_pept        complement(218251..218580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02530"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48500"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR23"
FT                   /protein_id="BAH48500.1"
FT                   /translation="MTAVATETEGEPEEAFGTEWLRLALRRCELLAQMHSVSSDARWMI
FT                   SFAIQWAPFGGASAAELLERFGVNRRRFMELVLDGLAPKAGDIQKIRAMKAQLRTSLVQ
FT                   AWGVQ"
     atgaccgccg tggcgacgga gaccgagggc gaaccggaag aagcgttcgg caccgaatgg        60
     ctgcgcctgg cgctgcggcg gtgcgagttg ctcgcgcaga tgcactccgt gagctcggat       120
     gcgcgctgga tgatcagttt cgcgatccag tgggccccgt tcggcggcgc gagcgcggcg       180
     gaactgctgg agcgattcgg cgtcaaccgc cgacgcttca tggaactggt gctcgacgga       240
     ctcgcgccga aggccggcga catccagaag atccgtgcga tgaaagctca gctgcggacc       300
     tccctcgtgc aggcgtgggg ggtgcagtag                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page