(data stored in ACNUC7421 zone)

EMBL: AP011115.PE254

AP011115.PE254       Location/Qualifiers
FT   CDS_pept        complement(218577..218966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02540"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48501"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR24"
FT                   /protein_id="BAH48501.1"
FT                   /translation="MTTDGMTRWQGIAQKCELMIQRCLNCTTLLAPLMATCSACQGSNL
FT                   ERVPSCGVGSIVSSKVVDRGLSGLDRGRVPCTIAIVELDEGPWVYTWIDGDVPAPSDCP
FT                   VRVEFRPASTAEQLPVFAVRAGDQR"
     gtgaccacgg acggaatgac ccgctggcag ggaatcgccc agaagtgcga actgatgatc        60
     cagcgctgcc tcaactgcac gaccctgctc gcgccgttga tggccacctg ctccgcctgc       120
     cagggttcga acctcgagcg ggtcccgtcc tgcggggtcg ggtcgatcgt gtcctcgaag       180
     gtggtcgatc gtgggctgag cggcctcgac cgcggccgcg tcccctgcac gatcgcgatc       240
     gtcgaactcg acgagggtcc gtgggtgtac acctggatcg acggggacgt cccggcaccg       300
     tcggactgcc cggttcgggt cgagttccgt cccgcgtcga cggcggaaca gctgccggtg       360
     ttcgccgtcc gcgccgggga tcagcgatga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page