(data stored in ACNUC7421 zone)

EMBL: AP011115.PE26

AP011115.PE26        Location/Qualifiers
FT   CDS_pept        22815..23573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00260"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00260"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48273"
FT                   /db_xref="GOA:C1AS24"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS24"
FT                   /protein_id="BAH48273.1"
FT                   /translation="MSTGASIGVLGGMIGLGGAEFRLPVLIGLFGFVALQAVIVNKAMS
FT                   LIVVLTALPARLMSVPYADLVPHWSVVVNLLCGSLVGAWVGATWATKMRSATLYKVLAV
FT                   LLVVIAIALGASHFGELGTLDLGPLSRTIAGLIAGFGIGVVAALMGVAGGELLIPTIVL
FT                   LYGVDIKIAGSLSLAVSLPTMLVAFARYSRDRSFGVLKANGRFVIAMSLGSIIGTVIGG
FT                   LLLGVVPETVLIPLLMLLLLASAVKVWRHH"
     gtgtccaccg gggcctcgat cggtgtgctc ggcggcatga tcggtctcgg cggtgccgag        60
     ttccggttgc cggtgttgat cggattgttc ggtttcgtcg ccttgcaagc cgtgatcgtg       120
     aacaaggcga tgagcctgat tgtggtcctc accgcgctcc cggccaggct catgtcggtt       180
     ccgtatgccg acctggtccc gcactggtct gtcgtggtca acctgctgtg cggcagtctc       240
     gtcggcgcct gggtgggggc gacctgggcg acgaaaatgc ggtcggccac gctctacaag       300
     gttctggccg tgctgctggt ggtgatcgcg atcgcgttgg gggcgagcca cttcggtgaa       360
     ctcggcacac tcgacctcgg cccgctctcc cggacgatcg ccgggttgat cgccggattc       420
     ggcatcgggg tcgtcgcggc gttgatgggt gtggcgggcg gtgaactcct catcccgacg       480
     atcgtgcttc tctacggggt ggacatcaag atcgccggga gtttgtcgtt ggcggtgtcc       540
     ttgccgacga tgctggtggc ctttgcccgc tacagccgag atcggagctt cggcgtgctg       600
     aaggcgaacg ggcgcttcgt gatcgcgatg tccctcgggt cgatcatcgg aaccgtgatc       660
     ggcggcttgt tgctcggggt ggtgccggag accgtgctga tcccgctgct gatgttgctg       720
     ttgctggcat cggcggtcaa ggtgtggcgg caccactga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page