(data stored in ACNUC7421 zone)

EMBL: AP011115.PE260

AP011115.PE260       Location/Qualifiers
FT   CDS_pept        251348..251686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48507"
FT                   /db_xref="GOA:C1AR30"
FT                   /db_xref="InterPro:IPR025182"
FT                   /db_xref="InterPro:IPR038638"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR30"
FT                   /protein_id="BAH48507.1"
FT                   /translation="MADRVLRGSRLGAVSYETDRDHDLAPRRMAKYRCDNGEVFDIPFA
FT                   DDAEIPGTWLCRNGLEGTLVEGTAPEAKKVKPPRTHWDMLLERRSKEELEELLKERLDL
FT                   LKAKRRGA"
     atggcagatc gcgtacttcg agggagtcga ctcggagcgg tgagctacga gaccgaccgt        60
     gaccacgacc tcgcgccccg tcggatggcc aagtaccggt gcgacaacgg tgaggtcttc       120
     gacattccct tcgccgacga tgccgagatt cccggcacgt ggctgtgccg taacggcctc       180
     gagggaactc tggtcgaggg cacggcgccc gaagccaaga aggtcaagcc gccgcgcacc       240
     cactgggaca tgctgctcga acgccgctcc aaggaggaac tggaagagct gctgaaggag       300
     cgcctcgacc tgctgaaggc gaagcgccgc ggagcctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page