(data stored in ACNUC7421 zone)

EMBL: AP011115.PE261

AP011115.PE261       Location/Qualifiers
FT   CDS_pept        complement(252246..281813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02610"
FT                   /product="putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02610"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48508"
FT                   /db_xref="GOA:C1AR31"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR31"
FT                   /protein_id="BAH48508.1"
FT                   /translation="MGSFPPPEWEMRTNKVVEAVPGGEVTAHGRIPDGAFPLSAAQRGM
FT                   WFAQQLDPSVPVTIAQCVELVGALDVALLSESLITAGRELGSAFLRLVEVDGVPYQLID
FT                   PTLEASVSVVDLQHEPDPRAAATEWMRQEYTTPLDVCRDRLVTSAVLRIGPNHHYWYCR
FT                   VHHVALDGMGSVTLVDRTAELYTAAVEGRAVAPSKAAELTDVARVDDEYRTSSRYLADG
FT                   EYWSERVSSIGEPHSLVDRTAPARARSRTTGGQILGPLADHLDAATNRHDSSAAFEVIA
FT                   AFAAYLARMTGREEVAVSLPVTARTTALLRRSGGMVSNVVPLRLDVRPDMTNTDLVAAV
FT                   RLEVTGALRHQRYPHMDIRRDAATDHQGFYGPLINVMLFHNEITLGSIVGRLELLSTGP
FT                   ISDLAVNVYHGVAGTSINLDLEANPDLYSDDALAAHHARFTRFLGAFLTSDTGTPRRIG
FT                   DLEILDEDECRILVPAAGRAGFAPVALPDLLAGAVRSNPDGDALVAPGHGTPDVTLSYR
FT                   ALDEESNRLARLLIDLQVGPEVSVALALPRSVESVSSVWAVAKSGAAFVPVDPGYPFER
FT                   IVHMLEDCGAPIGITTAALRAGLPDSTLWLVLDDDEFVSAVAAYPADPVTDADRTGVLM
FT                   VDHPAYVIYTSGSTGRPKGVAVSHRGVVNLAADERDRLGVSADSRVLHFASPSFDASVF
FT                   ELVMAVCAGAALVVAPTTMFGGVELAEFLAEHEVSHAFCTPAALASLDHRGLDHLTTVV
FT                   VAGDVCPPELVAKWAPGRIMVNAYGPTETTIMSSATGPMVPGQPVTIGSATVGVDLVVL
FT                   DHRLRPVPVGVRGELYVLGSSLARGYVHRAGLTAERFVASPFGTGGRMYRTGDVVRWGT
FT                   VPDGPPVLEFLGRSDFQVKIRGFRIELGEIDAALSAHPVVEFAHTVGYDDGSGRSRLVS
FT                   YVLPAPGTDVETRVLSEFVGTRLPGYMVPSSIMVLNMLPLTPAGKLDRNALPAPVFAAR
FT                   SADIVRPRTVSEEILLGIFRDVLGLPELSVDTSFFELGGNSLMATQVVSRVNAALDVRI
FT                   GVRDLFQSPSVSKLAATVANAGPQSDPRPALEPRERPDRMPLSVAQQRMWFLNQFDTAS
FT                   AAYNLPIALRLAGALDREALRAALGDVQERHEALRTVFPDSADGPHQLIKPAVSVLADT
FT                   DPLDVDPESLTAAVTALGSTGFDLTADTPLRAGLFREAPERHVLVLVVHHIAADGWSMT
FT                   PLAADVMVAYAARAAGHAPIWAPLPVQYVDYSLWQRDLLGSEDDPNSLSAKQIAHWRAA
FT                   LAGVPQLIELPTDRTRPAEMSHRGGRVEFTIPADVHGRLVDLAQSTGTTPFMVTHAALA
FT                   VLLRRLGAGSDIVIGTPVAGRGEEALDHLVGMFVNTLALRTTVDLGDTFEDVLARTRAA
FT                   DLAAFQHGDVPFERLVEVLSPARSSAHHPLFQVMLTFQNTANTRVELDGLEVEAAEIDV
FT                   QVAKFDLHLTVAENVDAAGNAAGLAVQLSYATDLFDHSTVVSIGERFGRLLDAVSGNPP
FT                   VAVGDLDLLDSREHAALTAANATHRPVPADTLASLFAAQAAATPDAVALVFDDRRLTYA
FT                   EFDERTDRLARHLIRTGVGPESVVAVGMRRSIDLLVAVYAIVKAGAAYLPIDPDHPAER
FT                   TAYVLDTAQPVCVLTRAADDTTFRTAAPVVNIDTLDLPDQDPTPISTALTAGNTAYVIF
FT                   TSGSTGRPKGVAVTHGAIVNRLLWMQHEYGLTPDDAVMQKTPVTFDVSVWELFWPLQVG
FT                   ASMVIAAPDGHRDPDYLATLIRRHRVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGE
FT                   ALTPEQVSRFRAVSGAGLHNLYGPTEAAVDVTYWETGAADALSVPIGRPVWNTQVHVLD
FT                   ARLHPVPNGVAGEVYLAGDQLARGYLNRADLSSDRFVANPFVAGGRMYRTGDLVRRRGD
FT                   GALEYLGRTDFQVKLRGQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGR
FT                   RAAEWSDVRAHLSTRVPSYMIPARVVHLDTLPLSVNGKLDRKALPPPTLDTATAEYIAP
FT                   QTPAEVVVAGVFAEILGVERVGTHDHFFDLGGNSLVATRLVSRLRIALGVPVSLRDVFD
FT                   APTVGALAHRLDRVDPAAHPAPPALTPQERPEQVPLSPAQQRVWFLNQFDTSSPVYNLP
FT                   LAVRFSGGLDVTALRRALRAVLHRHESLRTVFPASDSSPWQRILDEHDVDLDLTVVEAT
FT                   DAELAAAIRGFALAGFDVTTEIPVRARLLRVRNDEHVLVLVVHHIAADGWSFAPLSRDL
FT                   MVAYAAHSGGRDLQWAPLPVQYADYTLWQRELLGEKHDPDSRAARQLAYWATTLAGLPD
FT                   SLDLPTDRPRPSVASKHGATVSWEISTELHERLLTLARTQDTTLFMVAHSALSVLLSRL
FT                   SATTDIAIGTPVAGRGDRDLDDLVGMFVNTLVLRAQLDPASSFAELLQQVREVDLAAFA
FT                   HTDVPFERLVEHLNPTRTAAHHPLFQVALFFQNHAPAHLELPGLSVSSQPILPDVAAFD
FT                   LQLVLTDTRDADGTPGPITAEFNYATELFDESTIRSFGSQFVRILDAVTMAPHTPVGDI
FT                   AIAHPAARIRELSGWNATDHDVPDTTLPDLFGAQAARTPDAPAVVFDGASLTYREFDEH
FT                   ANRLARYLISCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVL
FT                   QSAGPVCVLTTTADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYT
FT                   SGSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGA
FT                   ALVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEA
FT                   LPPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDS
FT                   RLHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRD
FT                   GVLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPA
FT                   PDRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFTSDATEYV
FT                   APSTSVERAVASVFCAVLGLERVSVRDSFFELGGNSLIATQLVSRLRGELDVPVTVRDL
FT                   FETPTVAELAARLSQSTGADTRPALIRRERPERIPLSPAQQRMWFLNQFDPSSPAYNLP
FT                   FAVRFTGPLDRVALEAAVADLVERHESLRTVFPDSATGPHQVVRDTADAPPNLTVADIA
FT                   EDELETVLARFFTTGFDVTTDLPVRVTLLRVSAHEHVLALVVHHICGDGWSMAPMVRDV
FT                   MVAYTARTRGERPAWTPLPVQYADYALWQRELLGDESDPDTLAARQLDYWTDTLAGIPD
FT                   ELELPTDHPRPAEQSYRGSHVDFDIDASAHRALAALAQSRRATLFMVMHTALAVLLGRL
FT                   SASSDVTIGTPVAGRGEPELDDLIGMFVNTVALRTHVDPGSAFTDVLDHVRDVDLAAFS
FT                   RADVPFERLVEVLSPTRHAARHPLFQVMLTFQNLEQTALELDGLTLRGLGTDIDVAKFD
FT                   LHLTLVERFDPAGRPDGMTAQLTYATDLFDADTADSIAARFTTILGAVTTDATTRVGDI
FT                   ALLGADERAALTLWNSTEHAVPATTLPVLFDAQVARTPGAPALVLDGASLTYREFDEHA
FT                   NRLARYLVSCGVGPESRVALAMRRSLDLVVGMYAVVKAGGAYVPVDPDHPADRIGYVLQ
FT                   SAGPVCVLTTAADRGALPSGDVVTLDCLDLSDFSGAPVTDADRVYPLRADNTAYVIYTS
FT                   GSTGKPKGVAVPHAAIVNQLLWMQSQYALTGRDVVLQKTATTFDVSVWGFFWPLQVGAA
FT                   LVLAGPDGHRDPDYLARTIDELGVTVTDFVPSMLDVFVASVPADSCSSLRHVFVIGEAL
FT                   PPETASRFRDLSSAGLHNLYGPTEAAVSVTYWETSDADTVTVPIGVPEWNTQAYVLDSR
FT                   LHPVAAGVPGELYLGGVQLARGYLGRVDLTSDRFVANPFGGAGARMYRTGDLVRRRRDG
FT                   VLEYIGRTDFQVKFRGQRIELGEIETVLRSHPGVTGAAVVVYSDATTGDHLVAYVVPAP
FT                   DRVADTAEIRRHASGSLPSYMVPSAVVLLDEFPLNTSGKLDRKALPAPEFSSDATEYVA
FT                   PRNEVEQALAGVFADVLGAGRVGVHDSFFDLGGNSLSVTRLAARITETTGTRLSVRDVF
FT                   EAPTVADLAVRIDPTARDVRPALTAAPRPARIPLSLAQQRMWLLNQFDADSPAYNLPFA
FT                   VRLSGVVDTAALAAAFDDVVERHESLRTVFPDGGDGPEQVVLAVTDVSVTLPPVDVTEA
FT                   DLPGRMAALASRTFDVTAETPVRATLFRTAPTEHVLAISLHHIAADGWSFGPLGRDVMV
FT                   AYAARTDGHAPQWAPFEVQYADFSVWQRDVLGSEDDPESVLATQLGFWTRTLAGAPDEL
FT                   PLPFDRPRPAQPTFAGGSVGFDIDPETHRRIRSLARDHGATTFMVAHTAFALLMARLSA
FT                   TDDVAIGTPIAGRGERALDDLVGMFVNTLVLRTAVNGGATFAEMLRTVRDTDLAAFAHA
FT                   DVPFERLVDALAPTRTAARHPIYQVALSMNPLQSPDYELPGLRIGVEDVDPGVAKIDLQ
FT                   LTLGEELDHTGAPSGMRAEFIYATDLFDESTISDVASRLQRILEAVTSDPDTLVGDLDL
FT                   LHDAERDALVPASGRPGLIPVTLPDLLAGAVRSNPDGDALVAPGHGTSDGTLSYRALDA
FT                   TSNRLARLLIDLQVGPEVSVALALPRSRESVVATWAVTKSGAAFVPVDPNYPADRIAFM
FT                   LEDCGAPIGITTAALRENLPDSTLWLVLDDDAVIEALTSYSSEPVQDSDRVAALSVDHP
FT                   AYLIYTSGSTGRPKGVAVSHRGVVNLAADERVRLGVLSESRVLHFASPSFDASVFELMM
FT                   AVSAGATLVVAPTTIFGGEELAEFLAEQEVSHAFCTPAALASVNHRGLDSLTTVVVAGD
FT                   VCPPELVARWAPGRVMVNAYGPSEATIMSSATGPLVPGQPVTIGSPTVGVDLVVLDSRL
FT                   RPVPAGVRGELYVLGSSLARGYVRRSGLTAERFVASPFGSGGRMYRTGDVVRWVTAPDR
FT                   PPVLEFLGRSDFQVKIRGFRIELGEIDAALTAHPVVEFAHTIGFDDGSGHDRLVSYVLP
FT                   APAAEVDSRVLSEFVGERLPGYMVPSSIMVLDSLPLTPAGKLDRNALPTPVFAQRSEFT
FT                   APQTPAEQAIAAVFADVVGEPSIGLDDNFFDLGGNSLSATQVVSRVGSALGTRISVRTL
FT                   FDNPTVRALATAAASDTTAERPALVAGERPATIPLSPAQQRMWFLNQFDTTAAAYTIPL
FT                   ALRMSGRIDVATLRTALGDVLARHEALRTVYPATENGAHQVIVPVESIPLDLTPTRLSG
FT                   EDLSGAILRHASAGFDVTTDLPLRVHLFRESRSEHVLLFVVHHISADGWSFIPLASDVM
FT                   TSYAARTAGDAPVWNALPVQYADYAMWQRHLLGDSDDPQSLAASQIAYWKRTLAGLPDQ
FT                   VALPTDRPRPPAPSNLGGTARLTLDGDLHRQLHELARAHHASLFMVVHTALAALLSRLG
FT                   AGPDVAVGTSVAGRGEQSLDGLVGMFVNTLVLRTDVHPDSTGAALLEQVRRVDLEAFSH
FT                   VEVPFEQLVDAINPTRSTAFHPLFQVALALQNLQTPTLELPGLEVSALDIESPIAKFDL
FT                   NFVLGERHDEDGNPAGLDLELGYAKDLFDADTASRIGESFVRVLSGLAHDPRTPVGDLD
FT                   LLGDDARLRLLAQSHGATRETVHSTLVGLLDEQVRATPSAPAVRWRDTALTYAEFDACA
FT                   NRLARKLIADGVGPDAVVAVEIPRSLDLLVAVHAVVKAGGAYTPLDPGQPEQRNRDIVE
FT                   QSGASLVLTSSELLRQTGATRHGVRAIAPDALDPAEFGGEPIRAAERIAPLRPDNTAYV
FT                   LFTSGSTGRPKGVAVSHAAITAQLEWLREQYALGTADTMLLKTPVTFDVSVWECFAPLA
FT                   AGARLVIADPDGHRDPEYLAEIVRTHGVTVVHFVPAMLAALTSGPGLTDMPALRHVLVG
FT                   GEAVSPETIDDFRASHPAEIDNTYGPTEAAVTTTFFAARSDNSDTVPIGLPVWNTSTLV
FT                   LDDRLRPVPAGVAGELYLGGVQLARGYLGRPDLTAERFVADPFSTSGARLYRTGDLVRW
FT                   TAAGRLEYLGRTDFQVKVRGFRIELGEIVSALLRHEDVDQAVVVPHSDPHTGEHLVGYV
FT                   VPRGAVALDCDAVLAEAAGSLPSYMVPSLLVPLTELPLTPNGKVDRNALPAPVFAGKAE
FT                   YTAPRTESERVVAAVFAELLGVSRVGVDDNFFELGGNSLSATKLSTRIGVATQTRIAIR
FT                   DVFDAPTVAALARRLDQHGPSTAIAPLTAAVRPGRIPLSLAQQRMWFLNQFETSSPAYN
FT                   LPAAVRLTGSLDTAALAAAIGDLIARHESLRTVFPDSRGGPHQVILEPGDFTPDVAPVH
FT                   VSETGLRADLQEFLLAGFDVSEAVPLRVKVYSLGPAEHVLALVVHHISADGASMEPLIR
FT                   DVMIAYGSRAAGHPPTWAPLPVQYADYALWQRTVLGSESEPGSLAAAQLDYWTRALAGV
FT                   PDQLYLPGDRGRPAVPTHRGAATRFTLDAGTHRALTELARAHGASLFMVAHAALSVLLG
FT                   RLSTTADIAVGTAVAGRGRVELDDIIGMFVNTLVLRTTLDPGASFVALLAQTRTVDLEA
FT                   FAHADLPFERLVEVLSPVRSTSHHPLFQVALGVQAVSADGLELDGLSVTPLTLDASIAK
FT                   FDLHFTLTERLDDTAEPAGIDAELIYATDIFDESTAAGYATRLRRIFEAVVADPQRPIG
FT                   DIPVLGEDEHAALTPVRGADPRPVQMLPEILADAVAAAPDGLAVVFDGAGLTYRDLDER
FT                   SNQLARLLVDRGVGPETSVALALPRSFESVVAVWAVAKTGAAFVPVDPGYPADRIVHMV
FT                   QDSGAMVGITVSAKRALLPDSIRWMLLDDPALEVRCTHESRLPLTNRDRMRPILSDQVA
FT                   YVIYTSGSTGRPKGVAVTHRGLMNLVTDERELLAVTSRSRTLHFASPSFDASVFEMLMA
FT                   LGAGATMVIAPPTIYGGSELAELLAAERITHAFSTPAALASVDHHGLDELAVVVVAGDV
FT                   CPPELVARWAPGRRLVNAYGPSEATIMSSITEPLRAGEPVTIGGPSRGVRALVLDGRLR
FT                   PVPVGVPGELYVGGPSLARGYLGRPGLTAERFVADPYGEPGDLMYRTGDLVRWREDRVL
FT                   DFVGRTDHQVKIRGFRIELGEIDAALTAHPQIEYATTIGYEHPNGETSLVAYVLPFTGE
FT                   DVDRVEVANFVGRTLPAYMVPASVTLLDALPLTPAGKLDRSALPEPIFAAAATTFEAPR
FT                   NPMEVIVAGIFADILALPEIGIHDSFFDLGGNSLLATQVVSRINAALDVHVGVREVFES
FT                   PTVAALAARITETTTHGARRPALTARARPEHIPLSLAQQRMWFINQFDTASPAYNLPVA
FT                   LRLSGEVDLRAMQIAIADLVGRHEALRTVYPDSGDGPHQVIVPAADAVPDLTPVTAHPD
FT                   DVLERVLALVTTGFDVTSDVPLRARMYRVGADDYVLVMVAHHISGDGWSLAPLARDVML
FT                   AYTARTEGHVPLWTPLPVQYADYSLWQRELLGDEADPESVAAEQIAYWTRTLDGLPDRL
FT                   SLPTDRPRPAVASHRGAHVPFTIDAATHRALLTLARGRNTSLFMVMHTALAVLLARLSN
FT                   ESDIAVGAPIAGRGEESLDELVGMFVNTLVLRTHVDLASSFADSLNVARSTDLSAFAHS
FT                   DIPFERLVDVLNPARSRSHHPLFQVAFSFQNLATATLELPGLHVEGLDVPNTISTFDLH
FT                   LTLSEKHDADGTPDVIEAQFTYATDLFDDTTVRAFAERFTRILESVVRDPDLAVGAIDL
FT                   LGGAERQSVIAEFNDTAVDLPPTTLADLFSAQAVRTPDYPAVFFEGTELTYSEFDRRVD
FT                   ALAHRLIDSGVGPDTVVGLAMNRSIELLAGMYAVLRAGGAYLPIDLGHPADRLAYVLET
FT                   ARPVCVLTTSPDGFTAENVPVIEIDTLDLTGSPRGPVTDAHRRAPLRPENTAYLIFTSG
FT                   STGRPKGVAVSHAAIANQLRWKQHEYPLDTTDAVVQKTPVTFDLSVWELFWPLMSGARL
FT                   VISRPDGHRDPAYLADLMRQQRVTTAHFVPSLLEAFIPDAGEQPTLRRVLCIGEALPVD
FT                   TAARFRSRFASVALHNLYGPTEAAVSVTAWTHTDVDTDTVPIGGPEWNTQAFVLDARLN
FT                   PVPVGVAGELYLAGDQLARGYVARTDLTAERFVANPFGAPGARLYRTGDVVRWRIRGTT
FT                   GVLEYLERSDFQVKVRGFRIELGEIESALIRSAGVGQAVVVAHRNPHTGTALVAYVVPE
FT                   DGSTVDPTAVLADVGAAVPSYMVPAALVVLAELPLTANGKLDRKALPAPDFASAAAEYR
FT                   APATPTEEIVAAVYADVLGVEQVGTAANFFDLGGNSLVATRVVARLSETLGRRVEIRSL
FT                   FEAPAVGALAALLDSTDATAPTRPALTPAVRPELLPLSSAQQRMWFLNRFDPDSAVHNI
FT                   PVAVRLSGVLDVDALQHAVADVLHRHESLRTIYPDSADGPHQVILSTDRVGAETSVDAA
FT                   DEAALPALIADLVTTGFDVTAEVPVRVRIFRISATEHVLAVVVHHISGDGWSMAPMVRD
FT                   VMAAYSARSAGTSPDWAPLPVQYADYALWQRDLLGDETDPDSVAARQLAFWTQTLAGAP
FT                   DQLDLPTDRPRPAVASYRGGTVDFTVPADLHGTVVGAARDANASVFMVVHSALAVLLSR
FT                   LAGSGDISIGTPVAGRGERELDDLIGMFVNTLVLRQHVDGGRTFAELLADVRETDLAAF
FT                   SHADVPFERLVEVVNPSRSTGRHPLFQVMLTFQNLDQESLELGDLSVSGVDLDVDIAKF
FT                   DLQLTLMEQFDSEGGPDGIAARLTYAADLFDEPSAHVFGQRFLQVLRAAVDGPDTAVGD
FT                   LDVLGRGERKQIAGTNATAHPVLAGTLASLFDTAVAADPDRIAVVFDRDELTYANFDAR
FT                   VNRLARRLIEQGVGPESVVAVAMRRSIDLLVGIYAVVKAGGAYLPIDPDHPVERTAYVL
FT                   DTARPACVLVSGAGLADSGSVPVVDIASEDLSRYGSAPVTDRDRLRPLTAANTAYVIFT
FT                   SGSTGRPKGVAVTHGAIVNRLLWMQHEYALTSADVVLQKTPVTFDVSVWELFWPLQVGA
FT                   SMVIAAPDGHRDPRYLTGLVQERHVTTMHFVPSMLSVFTAEPAVAVCDSLRLVFCSGEA
FT                   LTPEQVSRFRGVSGAGLHNLYGPTEAAVDVTFWETGESDTHSVPIGRPVWNTQVHVLDA
FT                   RLHPVPNGVAGELYLAGEQLARGYLGRVDLTSDRFVANPFVAGGRMYRTGDLVRRRGDG
FT                   ALEYLGRTDFQVKLRGQRIELGEIESALEAHPDVVQAVVVVHRDERGDEALVAYLVGRR
FT                   AAEWSDVRAHLSTRVPSYMIPARVVHLDTLPLSVNGKLDRKALPAPEVRSAAAEYQPPR
FT                   SAAERAVATVFGEVLEIDRVGATDSFFDLGGNSLIATRVAAALGSELGIDFPLQWMFSD
FT                   PTPRSLGQRIQNAAIDGVPGAGASLDVLLPIRTRGTAEPVFCVHPFIGLAWSYAGLSRE
FT                   LTEDRPIYGLQSPALTEAEPHPGTITDFADRYVREIRSIQPHGPYHLVGWSLGGVIAHE
FT                   MAVQLQEAGEEVRLLGLLDSYVGLDRSVENTATTADLLGGAGLDLPEDGVLDELSPDGQ
FT                   FDAERAAALLRVVGGPLAALTAPELDRIYRNAQQAPDLIDAHRPRVFDGELVFFTAALD
FT                   DGFHVDPVTCWGPYVRGRIDEHPVDATHWTMTTPDALAAIAPHLARTQRRPRHAAPDPG
FT                   RDTDPDDSANRPHSVR"
     gtgggttcat tcccgccgcc ggagtgggaa atgaggacga acaaggtggt cgaagctgtg        60
     ccgggtggtg aggtgaccgc gcatggtcgc attccggacg gtgcgtttcc tctctccgcc       120
     gctcagcggg gcatgtggtt cgcccagcag ctcgatccct ccgtgcccgt caccatcgcg       180
     cagtgcgtcg aactggtcgg tgccctcgac gtggcgctgc tgtcggagtc gctgatcacg       240
     gcgggtcgcg aactcggctc cgccttcctc cggctggtcg aggtcgacgg cgttccctac       300
     cagctgatcg atccgacgct ggaggcatcg gtcagtgtgg tcgacctgca gcacgagccc       360
     gatccgaggg cggcggccac ggaatggatg cggcaggaat acaccacccc gctcgacgtg       420
     tgccgcgacc ggctggtgac ctcggcggtc ctgcgcatcg ggccgaatca ccactactgg       480
     tactgccgcg tgcaccacgt cgcgctcgac ggcatgggct cggtgacgct cgtcgaccgg       540
     accgcggagt tgtacaccgc ggccgtcgag gggcgcgctg tggcgccgtc caaggccgcc       600
     gaactcaccg acgtcgcccg cgtcgacgac gagtaccgga cgtcgtcgcg ctacctcgcc       660
     gacggggagt actggtccga gcgggtatcg agcatcggcg aaccgcacag tctcgtcgac       720
     cggaccgccc ccgcgcgggc acgcagccgc acgaccggcg ggcagatcct cggccccctc       780
     gccgaccacc tcgacgccgc gacgaaccgc cacgactcgt cggccgcgtt cgaagtcatc       840
     gccgccttcg ccgcctacct cgcccggatg accggacgcg aggaggtcgc ggtcagcctg       900
     cccgtcaccg cgcgcaccac cgcgctgctc cgccgctccg gcggcatggt gtccaacgtc       960
     gtcccgcttc gcctggacgt ccgcccggac atgacgaaca ccgacctggt ggcagcggtc      1020
     cggctggagg tcaccggggc gctccgccac cagcggtacc cgcacatgga catccggcgc      1080
     gacgccgcca ccgatcatca gggcttctac ggtccgctga tcaacgtcat gctgttccac      1140
     aacgagatca ccctcggcag catcgtcggc cgcctcgaac tgctgtccac cggccccatc      1200
     agcgacctcg ccgtcaacgt ctaccacggc gtcgccggca ccagcatcaa cctcgacctc      1260
     gaggccaacc ccgacctgta ctccgacgac gccctcgccg cgcaccacgc ccgcttcacc      1320
     cgattcctcg gcgccttcct cacctccgac accggcaccc cacgccgaat cggcgacctc      1380
     gagatcctcg acgaggacga atgccgcatc ctcgtccccg ccgccgggcg cgccggattc      1440
     gcaccggtcg cgctgccgga tctcctcgcg ggcgccgtgc gcagcaaccc ggacggtgac      1500
     gccctcgtcg cgcccgggca cgggacaccc gacgtcaccc tgagctaccg cgccctggat      1560
     gaggagtcca accggctcgc gcgcctcctg atcgatctcc aggtcggtcc cgaggtgtcg      1620
     gtggcgttgg cattgccgcg gtcggtggaa tcggtgtcga gtgtgtgggc ggtggcgaag      1680
     tcgggggcgg cgttcgttcc ggtggatccg ggttatccgt tcgagcggat cgtgcacatg      1740
     ctcgaggatt gcggtgcgcc gatcggtatc acgacggcgg cattgcgggc gggtctgccg      1800
     gattcgacat tgtggttggt tctcgacgac gacgaattcg tgtcggccgt tgccgcctac      1860
     ccggcggacc cggtgaccga tgcggaccgc accggtgtgc tgatggtgga tcatccggcg      1920
     tatgtgatct atacgtcagg gtcgacgggg cggccgaagg gtgtggcggt ttcgcatcgg      1980
     ggtgtggtga atcttgctgc ggacgagcgg gatcggctgg gggtgtcggc ggattctcgg      2040
     gtgttgcatt tcgcgtcgcc gagtttcgat gcctcggtgt tcgagttggt gatggcggtg      2100
     tgtgcggggg cggcgctggt ggtggcgccg accacgatgt tcggtggcgt cgagctggcg      2160
     gaattccttg ccgaacacga ggtgtcgcat gcgttctgca cacctgcggc attggcgtcg      2220
     ctcgatcacc gcggtctgga ccacctgaca acggtagtgg tggccgggga tgtgtgtccg      2280
     ccggagctgg tggcgaagtg ggctccgggt cggatcatgg tcaacgccta tgggccgacg      2340
     gagaccacca tcatgtcgtc ggcaaccggg ccgatggtgc ccgggcagcc ggtcaccatc      2400
     gggtctgcga cggtgggtgt cgacctcgtc gtcctcgacc accggttgcg tccggtcccg      2460
     gtcggggtgc gcggtgaact gtacgtcctc ggctccagct tggctcgcgg gtatgtgcat      2520
     cgggccgggt tgacggcgga gcggttcgtg gcgagcccgt tcggcactgg cgggcggatg      2580
     taccgcacgg gggacgtggt ccgctggggg accgtcccgg acgggcctcc ggttctggag      2640
     tttctgggcc gcagtgattt tcaggtgaag atccgggggt tccggatcga attgggtgag      2700
     atcgacgcgg cgctgtccgc gcatccggtg gtggagttcg cccacacggt cggctatgac      2760
     gacgggagcg gcaggagtcg cctggtctcg tatgttctgc cggcgccggg aactgacgtc      2820
     gaaacccggg tgttgtcgga gttcgtcggg acgcgtcttc ccggatacat ggtgccgtcg      2880
     tcgatcatgg tgttgaatat gttgccgctg accccggcgg gcaaactcga ccgcaacgca      2940
     ctgcccgcac cggtattcgc cgcacgctcg gccgacatcg tgcgcccgag aacggtcagc      3000
     gaagagatcc tcctcgggat cttccgcgac gtcctcggtc tccccgaact gagcgtcgac      3060
     accagtttct tcgaactcgg tggcaattcg ctgatggcca cgcaggtcgt gtcccgtgtg      3120
     aacgccgccc tcgacgtgcg gatcggggtc cgggacctct tccagtcgcc gtcggtgtcg      3180
     aaactggcgg ccacggtggc gaacgccggt ccgcagtccg acccgcgacc ggcgctggaa      3240
     ccccgggagc gacccgaccg catgcccctc tccgttgcgc agcaacggat gtggttcctc      3300
     aaccagttcg acaccgcgtc cgccgcctac aacctgccga tcgccctgcg gctcgccggc      3360
     gctctcgacc gggaagccct gcgggcggcg ctcggcgacg tccaggaacg gcacgaggcg      3420
     ctgcgcaccg tcttccccga cagcgcggac ggaccccacc agctgatcaa gcccgccgtg      3480
     agcgtgctgg ccgacacgga tccgctcgac gtcgaccccg agtcgctcac cgccgcggtg      3540
     acggccctcg gcagcaccgg gttcgacctc accgccgaca caccgctgcg cgccgggctg      3600
     ttccgtgagg cgcccgagcg gcatgtcctc gtcctcgtcg tccaccacat cgccgccgac      3660
     ggctggtcga tgacaccact cgccgccgac gtgatggtcg cgtacgcggc gcgcgccgcc      3720
     gggcatgcac ccatctgggc gccgctcccc gtgcagtacg tcgactacag cctctggcag      3780
     cgggacctac tggggtcgga agacgacccg aacagcctgt ccgccaagca gatcgcacac      3840
     tggcgggcag cgcttgccgg cgtgccgcag ctgatcgagc tgcccaccga ccgcacgagg      3900
     cccgccgaga tgtcgcatcg cggcgggcgt gtcgagttca cgatccccgc cgacgtccac      3960
     gggcgtctcg tcgatctcgc acagagcacc ggcacgacgc cattcatggt cacgcacgcc      4020
     gcgctggctg tattactccg ccggctcggc gccggatcgg acatcgtgat cggcacgccc      4080
     gtcgcgggac gcggcgagga ggccctcgac cacctcgtcg ggatgttcgt caacaccctt      4140
     gcgctccgta cgaccgtcga cctcggtgac acgttcgagg acgttctcgc ccggacccgc      4200
     gccgccgacc tcgccgcgtt ccagcacggc gacgtcccgt tcgagcgcct cgtggaggtg      4260
     ctcagccccg cccggtcgtc ggcgcaccat ccgctgttcc aggtgatgct cacgttccag      4320
     aacacggcga acacccgggt ggaactcgac ggactcgagg tcgaggccgc cgagatcgac      4380
     gttcaggtgg cgaaattcga cctgcacctc accgtcgcgg agaatgtcga tgccgccggc      4440
     aacgctgcgg gtctggccgt gcaactgtcc tacgcgacag acctgttcga ccacagcacg      4500
     gtcgtgtcga tcggcgaacg cttcggccgg ctcctcgacg cggtgtcagg caacccgccg      4560
     gtcgccgtcg gtgacctcga cctcctcgat tcgagggaac acgccgccct caccgcggcc      4620
     aacgcaacgc accgtccggt gccggcggac accctggcgt cgctgttcgc ggcccaggcc      4680
     gccgccaccc cggacgccgt ggcgctggtg ttcgacgatc gtcggttgac ctacgccgag      4740
     ttcgacgagc gcaccgaccg actcgcccgc cacctgatcc ggaccggcgt ggggccggag      4800
     tccgtcgtcg cggtcgggat gcggcgctcg atcgacctgc tggtcgccgt ctacgcgatc      4860
     gtgaaggccg gagccgcgta cctgccgatc gatcccgacc atccggccga gcgcaccgcg      4920
     tacgtgctcg acaccgcaca gccggtctgt gtgctgacac gcgccgcgga cgacaccacg      4980
     ttccgcaccg cagcaccggt ggtgaacatc gacaccctcg accttcccga ccaggatccg      5040
     acaccgatct ccaccgcgct caccgcgggc aacacggcgt acgtgatctt cacgtccggg      5100
     tcgacgggcc ggccgaaggg ggtcgcggtc acgcacggtg cgatcgtgaa ccgtctgctg      5160
     tggatgcagc acgagtacgg gctgacgccg gacgacgcgg tgatgcagaa gacgccggtg      5220
     acgttcgacg tgtcggtgtg ggagctgttc tggccgctgc aggtgggggc gtcgatggtg      5280
     atcgccgcac ccgacgggca ccgcgatccc gactacctcg ccaccctcat ccgccggcac      5340
     cgcgttacca ccatgcactt cgtgccgtcg atgttgtcgg tgttcactgc cgaacctgct      5400
     gtggcggtgt gtgattcgtt gaggttggtg ttctgttcgg gggaggcgct gacgccggag      5460
     caggtgtcgc ggttccgggc ggtcagtggt gcgggtctgc acaatctgta cggtccgacg      5520
     gaggctgcgg tcgatgtgac gtactgggag acgggcgcgg cggatgcgct gtcggtgccg      5580
     atcggtcgtc cggtgtggaa cacgcaggtg catgtgctcg atgcgcggtt gcatccggtg      5640
     ccgaacgggg tggcggggga ggtgtacctt gcgggtgacc aactcgcgcg cggctacctg      5700
     aatcgggcgg atctgtcctc ggaccggttc gtggcgaatc cgttcgtcgc gggtgggcgg      5760
     atgtaccgga cgggggatct ggtgcgtcgc cggggtgatg gggctctgga gtatctgggg      5820
     cgtacggatt tccaggtgaa attgcggggg cagcggatcg agttggggga gatcgagtcg      5880
     gcgctggagg cgcatccgga cgtcgtgcag gcggtggtgg tggtgcaccg ggacgagcgc      5940
     ggcgacgaag cgctcgtcgc gtacctggtg ggacggcgcg cggccgagtg gtccgacgtg      6000
     cgcgcacacc tgtcgacacg agtcccgtcg tacatgatcc cggcgcgcgt cgtgcacctg      6060
     gacaccctgc cgctgtcggt gaacggcaaa ctggaccgca aggccctgcc cccaccgacc      6120
     ctcgacactg cgaccgccga atacatcgcg ccgcagaccc cggccgaggt ggtcgtcgcc      6180
     ggtgtcttcg ccgagatcct gggcgtcgaa cgtgtcggca cccacgacca tttcttcgac      6240
     ctcggcggca actccctcgt cgccacccga ctggtgtcgc gactgcggat cgcactcggt      6300
     gtcccggtgt cgctgcgcga cgtcttcgat gcgccgacgg tcggcgcgct cgcgcacaga      6360
     ttggaccggg tcgaccctgc ggcgcacccc gcacctcccg cactgacccc gcaggagcgg      6420
     cccgagcagg tgccgttgtc gcctgcccag cagcgtgtgt ggttcctcaa ccagttcgac      6480
     acctccagcc ccgtctacaa tcttcctctc gccgtgcggt tctcgggggg cctggacgtc      6540
     acggcactgc gtcgcgcgct ccgcgcggta ctgcaccgcc acgaatcgct gcggaccgtg      6600
     ttccccgcat cggattccag cccctggcag cgcatcctcg acgagcacga cgtcgacctc      6660
     gacctcaccg tcgtcgaggc gaccgacgcc gaactcgcgg ccgcgatccg gggattcgcc      6720
     ctcgccggct tcgacgtcac caccgagatt ccggtacgcg ctcgactgtt gcgcgtgcgt      6780
     aacgacgaac acgtgcttgt tctcgtcgtg caccacatcg ccgccgacgg atggtcgttc      6840
     gcgccgctgt ctcgcgacct gatggtcgcg tacgccgcgc acagcggcgg ccgcgacctg      6900
     cagtgggccc cgctgcccgt gcagtacgcc gactacacac tgtggcagcg cgaactcctc      6960
     ggcgagaagc acgacccgga ctcgcgggcg gcccgccaac tcgcgtattg ggcaaccacg      7020
     ctggccgggc tgccggacag cctcgacctg cccaccgacc ggccacgacc cagcgtcgcg      7080
     tcgaagcacg gagccaccgt gtcgtgggag atctccacgg aactgcacga gcgcctgctg      7140
     accctggccc gcacacagga caccaccctg ttcatggtcg cgcactccgc gctgtcggtg      7200
     ctgctcagcc ggctcagcgc gaccaccgac atcgccatcg gcacccccgt cgccggccgc      7260
     ggcgaccgtg acctcgacga cctggtcggc atgttcgtca acaccctcgt gctccgcgcg      7320
     caactggacc cggcgtcgtc gttcgccgaa ctgttgcaac aggtccgaga ggtggacctc      7380
     gccgcattcg cacacacgga cgtgccgttc gaacgtctgg tggagcacct gaaccccacc      7440
     cgtaccgcag cacaccaccc gctgttccaa gtggcgctgt tcttccagaa ccacgccccc      7500
     gcgcacctcg aactccccgg cctgtcggtg tcgagccaac cgatcctccc cgacgtcgcc      7560
     gcgttcgacc tgcaactcgt cctcaccgac acccgcgacg ccgacggcac acccggcccc      7620
     atcaccgccg aattcaacta cgccaccgaa ctgttcgacg agagcacgat ccgatcgttc      7680
     ggtagccagt tcgtccggat cctcgacgcc gtcacgatgg cgccgcacac gccggtcggc      7740
     gacatcgcga tcgcgcaccc cgccgcgcgc atccgagaac tgtccggatg gaatgccacc      7800
     gaccacgacg tccccgacac caccctgccg gatctgttcg gcgcacaggc ggcgcgcact      7860
     cccgatgccc cggcggtggt gttcgacggc gcctcgctga cgtaccgcga gttcgacgag      7920
     cacgcgaatc ggctcgcccg gtatctgatc tcgtgtggag tggggcccga gtcgcgggtc      7980
     gcgctggcga tgcggcggtc gttggacctg gtggtgggga tgtacgccgt ggtgaaggcg      8040
     ggcggtgcgt atgtgcccgt cgacccggat catcccgccg accggatcgg atacgtgctg      8100
     cagtctgccg ggccggtctg cgtcctgacg acgaccgcgg atcgcggcgc gcttccgtcc      8160
     ggcgacgtgg tcacgctcga ctgccttgac ctgtccgact tctccggcgc acctgtcacc      8220
     gacgccgacc gggtgtatcc cctgcgcgcg gataacaccg cttatgtcat ctatacgtcg      8280
     ggttcgaccg gcaagccgaa gggtgtggcg gttccgcatg ccgcgatcgt gaatcagttg      8340
     ctgtggatgc agtcgcagta cgcgctgacc ggccgggatg tggtgttgca gaagacggcg      8400
     accacgttcg atgtgtcggt gtgggggttt ttctggccgt tgcaggtggg ggccgccctg      8460
     gtgttggccg gcccggacgg ccatcgcgat ccggactatc ttgcgcggac catcgacgaa      8520
     ctcggggtga cggtcaccga tttcgtgccg tcgatgctcg atgtgttcgt cgcgtcggta      8580
     cccgccgact cgtgttcgag tctgcggcac gtgttcgtga tcggtgaggc gctgcctccc      8640
     gagaccgcga gtcgtttccg ggacctgtcg tccgccggat tacacaactt gtatggaccc      8700
     accgaggcag cggtgtcggt gacgtactgg gagacgtccg atgcggacac cgtgacggtg      8760
     ccgatcggcg ttccggagtg gaacacgcag gcgtacgtgc tggattcgcg tctgcatccg      8820
     gttgctgcgg gggtgccggg ggagttgtat ctgggcgggg tccagttggc gcgggggtat      8880
     ctgggtcggg tggatctgac gtcggaccgg ttcgtggcga acccgttcgg gggtgccggt      8940
     gcgcggatgt accggacggg ggatctggtg cggcgccggc gtgacggtgt gctggagtac      9000
     atcgggcgta ccgattttca ggtgaagttc cgcggtcagc ggatcgagtt gggtgagatc      9060
     gagacggtgc tgcggtcgca tccgggtgtg accggtgccg cggttgtggt gtattcggat      9120
     gccacgaccg gtgatcattt ggtggcgtat gtggttcccg cgcccgaccg cgttgccgac      9180
     accgcggaga ttcgccggca cgcttcgggt tcgctgccgt catacatggt gccgtcggcg      9240
     gtggtgttgc tggacgagtt cccgttgaac acgagtggga agttggatcg gaaggcgctg      9300
     cctgctcccg agttcacctc ggatgcaacc gaatacgtgg caccgtccac gagcgtcgag      9360
     cgtgctgtcg catcggtgtt ctgcgcggtc ctcggactcg agcgggtgag cgtccgggac      9420
     agtttcttcg aactcggcgg caactcgctg atcgccaccc aactggtgtc ccgactccgc      9480
     ggtgaactcg atgtgcccgt cacggtgcgg gacctgttcg agactccgac cgtcgcggaa      9540
     ctcgcggcca gactgtcgca gtcgaccggt gcggacaccc gaccggcgct gatccggcgg      9600
     gaacggccgg aacgtattcc gctgtcgcct gcccagcagc ggatgtggtt cctcaaccag      9660
     ttcgatccgt cgtccccggc ctataacctg ccgttcgcgg tgcgcttcac cgggccactc      9720
     gaccgggtgg cgctcgaggc ggccgtcgcg gacctcgtcg aacggcacga gtcgctgcgg      9780
     accgtgttcc ccgattcggc gaccgggccg caccaggtcg tgcgcgacac tgcggatgcc      9840
     ccgccgaatc tgactgtcgc ggacatcgcc gaggacgaac tcgagaccgt cctggcgcga      9900
     ttcttcacga cgggtttcga cgtcacgacg gacctgcctg tccgtgtcac gttgctccgg      9960
     gtgagcgccc acgaacacgt gctggcgctg gtggtgcacc acatctgcgg cgacggctgg     10020
     tcgatggcac cgatggtgcg cgatgtgatg gtcgcctaca cggcccgcac ccggggagag     10080
     cgccccgcct ggacgccgct gcccgtgcag tacgccgact acgccctctg gcagcgcgaa     10140
     ctcctcggtg acgaatcgga ccccgatacc ctcgccgccc ggcagctcga ctactggacc     10200
     gacaccctcg cgggcattcc cgacgaactg gaactcccga cggaccaccc gcgccccgcc     10260
     gagcagtcct atcgcggcag ccacgtcgac ttcgacatcg acgcgtccgc gcaccgcgca     10320
     ctggcggcac tcgcgcagtc ccggcgggcc acgctgttca tggtgatgca caccgccctc     10380
     gccgtgctgc tcggacgtct cagcgcgtcg tcggacgtca ccatcggaac tcccgtcgcc     10440
     ggtcgcggcg aacccgaact cgacgatctg atcggcatgt tcgtcaacac ggtggccctg     10500
     cggacccacg tcgatccggg gtccgcgttc accgacgtgc tcgaccacgt ccgggatgtg     10560
     gatctcgcgg cgttctcccg cgccgacgtg cctttcgaac ggctggtgga ggtgctcagc     10620
     cccacccggc acgcggcccg gcacccgttg ttccaggtga tgctcacgtt ccagaatctc     10680
     gagcagaccg cactcgaact cgacggactc accctgcgcg gactcggcac cgacatcgac     10740
     gtcgcaaaat tcgatctgca cctgaccctc gtcgagcggt tcgaccccgc aggtagaccc     10800
     gacgggatga ccgcgcaatt gacgtacgcg accgatctgt tcgacgcgga cacggccgac     10860
     tccatcgccg cccgattcac cacgatcctc ggcgccgtca ccaccgacgc gacgacccgc     10920
     gtcggcgaca tcgccctgct cggcgccgac gagcgtgccg cattgaccct ctggaactcg     10980
     accgaacacg cggtccccgc gacgaccctg ccggtgctgt tcgatgcgca ggtggcgcgt     11040
     actcccggtg ccccggccct ggttctcgac ggcgcctcgc tgacgtaccg cgagttcgac     11100
     gagcacgcga atcggttggc tcggtatctg gtgtcgtgtg gagtggggcc ggagtcgcgg     11160
     gtcgcgctgg cgatgcggcg gtcgttggac ctggtggtgg ggatgtacgc cgtggtgaag     11220
     gcgggcggtg cgtatgtgcc cgtcgacccg gatcatcccg ccgaccggat cggatacgtg     11280
     ctgcagtctg ccgggccggt ctgcgtgctg acgactgccg cggatcgcgg cgcgcttccg     11340
     tccggcgacg tggtcacgct cgactgcctt gacctgtccg acttctccgg cgcacctgtc     11400
     accgacgccg accgggtgta tcccctgcgc gcggataaca ccgcttatgt catctatacg     11460
     tcgggttcga ccggcaagcc gaagggtgtg gcggttccgc atgccgcgat cgtgaatcag     11520
     ttgctgtgga tgcagtcgca gtacgcgctg accggccggg atgtggtgtt gcagaagacg     11580
     gcgaccacgt tcgatgtgtc ggtgtggggg tttttctggc cgttgcaggt gggggccgcc     11640
     ctggtgttgg ccggcccgga cggccatcgc gatccggact atcttgcgcg gaccatcgac     11700
     gaactcgggg tgacggtcac cgatttcgtg ccgtcgatgc tcgatgtgtt cgtcgcgtcg     11760
     gtacccgccg actcgtgttc gagtctgcgg cacgtgttcg tgatcggtga ggcgctgcct     11820
     cccgagaccg cgagtcgttt ccgggacctg tcgtccgccg gattacacaa cttgtatgga     11880
     cccaccgagg cagcggtgtc ggtgacgtac tgggagacgt ccgatgcgga caccgtgacg     11940
     gtgccgatcg gcgttccgga gtggaacacg caggcgtacg tgctggattc gcgtctgcat     12000
     ccggttgctg cgggggtgcc gggggagttg tatctgggcg gggtccagtt ggcgcggggg     12060
     tatctgggtc gggtggatct gacgtcggac cggttcgtgg cgaacccgtt cgggggtgcc     12120
     ggtgcgcgga tgtaccggac gggggatctg gtgcggcgcc ggcgtgacgg tgtgctggag     12180
     tacatcgggc gtaccgattt tcaggtgaag ttccgcggtc agcggatcga gttgggtgag     12240
     atcgagacgg tgctgcggtc gcatccgggt gtgaccggtg ccgcggttgt ggtgtattcg     12300
     gatgccacga ccggtgatca tttggtggcg tatgtggttc ccgcgcccga ccgcgttgcc     12360
     gacaccgcgg agattcgccg gcacgcttcg ggttcgctgc cgtcatacat ggtgccgtcg     12420
     gcggtggtgt tgctggacga gttcccgttg aacacgagtg ggaagttgga tcggaaggcg     12480
     ctgcctgctc ccgagttcag ctcggatgca accgaatacg tggcaccgcg caacgaggtg     12540
     gaacaggcgc tcgccggcgt gttcgccgac gtgctcggtg ccggccgggt cggtgtgcac     12600
     gacagcttct tcgacctcgg cggcaactcg ctgtcggtca cccgccttgc cgcgcgcatc     12660
     accgagacga ccggaacccg gctgtcggta cgcgacgtgt tcgaggcacc gaccgtggca     12720
     gacctggcag tgcgcatcga ccccaccgcg agggacgtgc gccccgcgct gacggcagcg     12780
     ccccggcccg cccgcatccc gttgtcgctg gcgcagcagc gtatgtggct cctcaaccag     12840
     ttcgacgccg actccccggc ctataacctg ccgttcgcgg tacgcctgtc cggcgtcgtc     12900
     gacaccgcag cgctggcggc cgcgttcgac gacgtcgtcg aacgtcacga gtcgctgcgg     12960
     acggtgttcc cggacggcgg ggacggccct gagcaggtcg tactggccgt caccgacgtc     13020
     tccgtgacac tgcctccggt cgacgtcacc gaagccgatc tccccggccg gatggcggcg     13080
     ctcgcgtccc gaaccttcga cgtcaccgcc gagacaccgg tacgggccac gctgttccgc     13140
     accgcgccca ccgagcacgt cctggcgatc tcgctgcatc acatcgcggc cgacggctgg     13200
     tctttcggac cactcggccg tgacgtcatg gtcgcctacg cagcccgcac ggacggccac     13260
     gccccgcagt gggcaccgtt cgaggtccag tacgccgact tcagcgtgtg gcagcgggac     13320
     gtactcggca gcgaagacga cccggaatcc gtcctggcca cccaactcgg attctggacc     13380
     cgaacgctcg ccggggcgcc cgacgaactg cccctgccct tcgaccggcc acggcccgcg     13440
     caaccgacgt tcgccggcgg atcggtgggc ttcgatatcg accccgaaac tcaccgtcgc     13500
     attcgatcac tggcccggga ccacggggcc accaccttta tggtcgccca caccgccttc     13560
     gcgctgctga tggcacgact gtcggccacc gacgacgtcg cgatcggcac cccgatcgcc     13620
     ggccgcggcg aacgcgccct cgacgacctc gtcggaatgt tcgtcaacac cctcgtcctg     13680
     cgcacagccg tgaacggcgg agccaccttc gccgagatgc tgcgtacagt ccgcgacacc     13740
     gacctcgcag cgttcgccca cgccgacgtc ccgttcgaac ggctggtcga cgccctcgcc     13800
     cccacacgca ccgcggctcg tcaccccatc taccaggtcg cgctgtcgat gaacccgctg     13860
     cagtcaccgg actacgaact gccgggactg cggatcggcg tcgaggatgt ggatcccggg     13920
     gttgccaaga tcgacctcca gctgacactg ggcgaggaac tcgatcacac gggcgcaccg     13980
     tccggtatgc gtgccgaatt catctacgcc accgacctgt tcgacgagtc caccattagc     14040
     gacgtcgcat cgcggctgca gcggattctc gaggccgtga cgtccgaccc ggataccctg     14100
     gtcggtgacc tcgatctact ccacgacgcc gagcgggacg cactggtccc ggcaagcggc     14160
     cggcccgggc tcataccggt cacactgccg gatctgctgg ccggcgccgt ccgcagcaac     14220
     ccggacggtg acgccctcgt cgcgcccggg cacgggacat ccgacggcac cctgagctac     14280
     cgcgccctgg atgcaacgtc gaaccgactg gcgcggttgc tgatcgacct gcaggtcggt     14340
     cccgaggtct cggtggcgtt ggcgttgccc cgctctcggg aatcggtggt ggctacgtgg     14400
     gcggttacga agtcgggcgc cgcgttcgtt ccggtggatc cgaactatcc ggctgaccgc     14460
     atcgcgttca tgctcgagga ctgtggtgcg ccgatcggca tcaccaccgc cgcgctgcgg     14520
     gagaacctgc cggattcgac tttgtggttg gttctcgacg acgatgccgt gatcgaggct     14580
     ctgacatcgt attcctcgga acccgtgcag gattcggatc gagttgccgc gttgtcggtg     14640
     gatcatccgg cgtatctgat ttacacatcg ggctcgacgg ggcggccgaa gggtgtggcg     14700
     gtttcgcatc ggggtgtggt gaatcttgct gcggatgagc gggttcggtt gggggtgttg     14760
     tcggagtctc gggtgttgca tttcgcgtcg ccgagtttcg atgcgtcggt gttcgagttg     14820
     atgatggcgg tgagtgcggg ggcgacgctg gtagtggcgc cgaccacgat cttcggtggc     14880
     gaagagttgg cggagttcct ggccgagcag gaggtgtcgc atgcgttctg cacgccggcg     14940
     gcgttggcgt cggtgaatca ccgcggtctg gattctctga cgacggtagt ggtggccggg     15000
     gatgtgtgtc cgccggagct ggtggcgcgg tgggctccgg gccgggtgat ggtgaatgca     15060
     tatggtccga gtgaggcgac gatcatgtcg tcggcgacgg gtccgttggt accggggcag     15120
     ccggtcacca tcgggtcgcc gaccgtgggt gtcgatctcg ttgtgctcga ttcccggttg     15180
     cgtccggttc cggcgggggt gcggggtgaa ctgtatgttc tcggttcgag tttggctcgg     15240
     gggtatgtgc gccggtcggg gttgacggcg gagcgttttg tggcgtcgcc gttcgggtcc     15300
     ggtggtcgga tgtatcgcac gggggatgtg gtgcggtggg tgaccgcgcc ggaccggccg     15360
     ccggttctgg agtttctggg gcgcagtgat tttcaggtca agatccgggg attccggatc     15420
     gagttgggtg agatcgacgc ggcgctgacc gcgcatccgg tggtggagtt cgcgcacacg     15480
     atcgggttcg acgacggttc cggtcatgat cggctggtgt cgtatgtgct gccggcgccg     15540
     gcagccgagg tcgattcccg ggtgttgtcg gagttcgtgg gggagcgtct tcccgggtac     15600
     atggtgccgt cgtcgatcat ggtgttggat tcgctgccgc tgaccccggc gggcaagctc     15660
     gaccgcaacg ccctgcccac acccgttttc gcgcagcgga gcgagttcac ggcaccgcag     15720
     accccggccg agcaggcgat cgccgccgtc ttcgccgacg tcgtggggga gccgtcgatc     15780
     ggcctcgacg acaacttctt cgacctcggc ggcaactcgc tgtccgccac ccaggtcgtc     15840
     tcccgtgtcg gttcggcact gggaacacgc atctccgtcc gcacactgtt cgacaacccc     15900
     accgtgcgcg cactcgcgac cgccgcagcg tccgacacga cggccgagcg gcccgccctc     15960
     gtcgccggtg agcgacccgc cacgatcccg ctgtcgccgg cacagcaacg catgtggttc     16020
     ctcaaccagt tcgacaccac cgcggccgcc tacaccattc cgctcgcgct ccgcatgtcc     16080
     ggccggatcg acgtcgcgac cctgcgcacc gcactcggcg acgtccttgc ccggcacgag     16140
     gcactgcgca ccgtctaccc ggcgaccgag aacggtgcgc accaggtgat cgttccggtg     16200
     gagtcgatcc ccctcgacct cacgcccacc cgactgtccg gcgaagacct ctccggtgcg     16260
     atcctgcgcc acgcctccgc cgggttcgac gtcaccaccg acctgccgct gcgggtccac     16320
     ctgttccgcg agagccggtc ggagcacgtc ctgctgttcg tcgtccacca catctccgcg     16380
     gacggctggt cgttcatccc tctcgcgtcc gacgtgatga cgtcctacgc cgcccggacc     16440
     gccggcgacg ccccggtgtg gaacgcgttg ccggtgcagt acgcggacta cgcgatgtgg     16500
     cagcggcacc tgctcggtga ctccgacgat ccgcagtcgc tcgccgcgag tcagatcgcg     16560
     tactggaagc ggacactcgc aggactgccg gatcaggtcg cactgcccac cgaccgcccc     16620
     cgcccaccgg ccccgtcgaa cctcggcggc acggcgcgac tgaccctgga cggcgacctc     16680
     caccggcaac tgcacgaact ggcgcgcgca caccacgcca gcctgttcat ggtcgtccac     16740
     accgcgctgg ccgcactgct gtcccggttg ggggccggcc cggatgtcgc cgtcggaacg     16800
     tccgtcgcgg gccgcggcga gcagtccctc gacgggctcg tcggcatgtt cgtcaacacg     16860
     ctggtgctgc gtaccgacgt acaccccgac tcgacgggcg ccgcactgct cgaacaggtc     16920
     cggcgcgtcg acctcgaggc gttctcccac gtggaggtgc cgttcgagca actcgtcgac     16980
     gcgatcaacc cgacccgctc gaccgcgttc cacccgctgt tccaggtggc gctcgcgctg     17040
     cagaacctgc agaccccgac gctcgaactg ccgggactgg aagtgtccgc actcgacatc     17100
     gagtcgccga tcgccaagtt cgacctgaac ttcgtgctcg gtgaacgcca cgacgaggac     17160
     gggaatccgg cgggcctcga cctcgaactc ggctacgcca aggacctttt cgacgcagac     17220
     accgcctcga ggatcggcga gtccttcgtc cgggtgctgt ccggactggc ccacgatccg     17280
     cgaaccccgg tcggcgacct cgacctgctc ggcgacgacg cccggctgcg tctcctcgct     17340
     cagtcccacg gtgcgacacg ggagacggtg cactccaccc tcgtcggtct gctcgacgaa     17400
     caggtacggg caaccccgag cgcccccgcc gtgcgctggc gcgacacggc tctgacctac     17460
     gccgaattcg acgcctgcgc gaaccgcctc gcacgcaagc tcatcgccga cggggtgggc     17520
     cccgacgccg tcgtggccgt ggagatcccg cggtcgctcg acctgctcgt cgcggtccac     17580
     gccgtggtga aggccggcgg cgcctacacc ccactcgacc ccggccaacc ggagcagcgc     17640
     aaccgcgaca tcgtcgaaca gtccggcgcg tccctggtgc tcaccagcag cgaactgctc     17700
     aggcagaccg gagcgacccg gcacggagtg cgggcaatcg cgccggacgc cctcgacccg     17760
     gccgagttcg gcggggagcc gatccgcgcc gccgaacgaa tcgcgccgct gcgcccggac     17820
     aacacggcgt acgtcctctt cacgtccgga tccacgggac ggcccaaggg cgtggccgtc     17880
     tcgcacgcgg cgatcacggc gcaactcgag tggctacgtg agcagtacgc gctcggcacc     17940
     gccgacacga tgctgctcaa gaccccggtg acgttcgatg tgtcggtgtg ggagtgcttc     18000
     gcgccgctcg cagccggcgc ccgcctcgtc atcgcggatc ccgacggcca ccgcgacccc     18060
     gagtacctcg cggagatcgt ccgcacgcac ggcgtcaccg tcgtgcactt cgtgccggcg     18120
     atgctggcgg ccctcacctc cggccccgga ctgacggata tgcccgcgct gcggcacgtg     18180
     ctggtcggtg gcgaggcggt gtccccggag acgatcgacg acttccgtgc gtcccatccc     18240
     gccgagatcg acaacacgta cggacccacc gaggcggcgg tgaccaccac cttcttcgcg     18300
     gcacggtccg acaactccga caccgtcccg atcggcctgc ccgtctggaa caccagcact     18360
     ctcgttctcg acgaccgtct ccgcccggtc cccgccgggg tggcgggaga gctgtacctc     18420
     ggcggggtcc aactcgctcg cggatacctg ggccgccccg acctcaccgc cgaacgtttc     18480
     gtcgccgacc ccttctcgac gtcgggtgcg cggctgtacc gcaccggcga cctcgtccgc     18540
     tggaccgcgg cgggccggct cgagtacctc gggcgcaccg acttccaggt gaaggtccgc     18600
     ggtttccgca tcgaactcgg cgaaatcgtc tccgcgctgc tccggcacga ggacgtggac     18660
     caggcggtcg tcgtcccgca ctcggatccg cacaccggtg agcacctggt cgggtatgtc     18720
     gtgccgcgcg gcgcagtcgc attggactgt gacgccgtcc tggccgaagc ggcgggcagc     18780
     ctgccctcct acatggttcc gtcgctgctg gtcccgttga cggaactgcc gctgacgccg     18840
     aacggcaagg tggaccggaa cgccctgccc gcaccggtat tcgcagggaa ggcggagtac     18900
     acggcgccgc gcaccgagtc ggaacgcgtc gtggcggccg tcttcgccga gctcctcggc     18960
     gtttcccgcg tcggtgtcga cgacaacttc ttcgaactcg gcggcaactc gctgtcggcc     19020
     accaaactca gtacccgcat cggtgtggcg acgcagacgc ggatcgccat ccgcgacgtg     19080
     ttcgacgccc ccaccgtcgc ggccctggcc cggcggctcg accagcacgg tccgtccacc     19140
     gcgatcgcac cgctgacggc ggcggtccgt cccggccgga taccgctgtc gctcgcgcag     19200
     cagcggatgt ggttcctcaa ccaattcgaa acgtcctcgc ccgcctacaa cctgcccgcc     19260
     gcggtccggc tgacgggatc gctggacacg gcggcgctgg ccgcggcgat cggtgacctg     19320
     atcgcccggc acgaatcgct gcggaccgtc ttccccgact cgcggggtgg gccgcaccag     19380
     gtgattctcg agcccggaga cttcaccccc gacgtcgcac cggtccacgt gagcgagacc     19440
     gggttgcgcg cggatctcca ggagttcctc ctggccggtt tcgacgtgtc cgaggccgtg     19500
     ccgctgcggg tgaaggtgta ctcgctcggc cccgccgagc acgtgctcgc cctcgtcgtc     19560
     caccacatct ccgccgacgg tgcgtccatg gaacctctga tccgcgacgt gatgatcgcc     19620
     tacgggagcc gtgccgcggg ccacccaccc acctgggcgc cgctgccggt gcagtacgcc     19680
     gattacgcgc tgtggcagcg gacggtgctc ggctccgagt ccgagccggg cagcctcgcc     19740
     gccgcccaac tggactactg gacccgtgcc ctcgccggtg tcccggacca gctgtacctg     19800
     cccggcgacc ggggcaggcc cgcggtgccg acccatcgcg gtgcggcgac ccgtttcacc     19860
     ttggacgccg gcacacaccg ggccctgacg gagctcgcac gggcgcacgg cgcgagcctc     19920
     ttcatggtcg cccacgccgc gctcagcgtc ctcctgggac gcctcagcac caccgccgac     19980
     atcgcggtcg gcaccgccgt cgccggccgc ggccgagtcg aactcgacga catcatcggc     20040
     atgttcgtca acaccctcgt cctgcggacg acgctggatc cgggagcgtc gttcgtggcg     20100
     ctgctcgcgc agacgcggac cgtcgacctc gaggcgttcg cccacgccga cctgcccttc     20160
     gagcggctgg tggaggtcct gagcccggtc cgctccacct cgcaccaccc gctgttccag     20220
     gtggcgctcg gtgtgcaggc cgtgtccgcc gacggactgg aactggacgg gctgtcggtg     20280
     acaccgctca ccctcgacgc gagcatcgcc aagttcgacc tgcacttcac gctcaccgag     20340
     cggctcgacg acaccgccga acccgcgggc atcgacgccg aactcatcta cgcgaccgac     20400
     attttcgacg agagcacggc cgccgggtac gcgacccggc tgcgccggat cttcgaggcg     20460
     gtggtcgccg acccgcagcg gccgatcggt gacatccccg ttctcggcga agacgaacac     20520
     gcggcgctga ccccggtccg cggcgccgac ccgcgaccgg tgcagatgct gcccgagatc     20580
     ctcgccgacg ccgtggccgc agcacccgac ggtctcgccg tcgtcttcga cggtgccggc     20640
     ctgacatacc gggacctcga cgaacggtcg aatcagctgg cccggttgct cgtcgaccgg     20700
     ggagtgggac ccgaaaccag cgtcgcgctg gcgctgccgc ggtccttcga gtcggtggtg     20760
     gccgtctggg cggtggccaa gaccggtgcc gccttcgtac ccgtcgaccc cggctatccc     20820
     gccgaccgca tcgtgcacat ggtgcaggac tccggggcga tggtcgggat cacggtgtcc     20880
     gcgaagcggg cactgctccc ggactcgatc cggtggatgc tcctcgacga cccggcactg     20940
     gaggtgcgct gcacccacga gtcccggttg cctctcacca accgcgaccg catgcggccg     21000
     atcctgtccg accaggtggc gtacgtcatc tacacgtcgg gatcgaccgg caggcccaag     21060
     ggcgtcgcgg tgacgcaccg cggtctgatg aacctggtga ccgacgaacg tgagctgctc     21120
     gccgtcacgt cccgttcgcg gacactgcat ttcgcgtccc cgagcttcga tgcctccgtg     21180
     ttcgagatgc tgatggcact cggcgcggga gccacgatgg tgatcgcgcc gcccacgatc     21240
     tacggcggat cggaactcgc ggaactgctc gcggcggaac gcatcaccca tgcgttctcc     21300
     acccccgcgg cgctggcgtc ggtggaccac cacgggctcg acgaactcgc cgtggtggtc     21360
     gtcgccggtg acgtgtgccc gccggaactg gtcgcccgct gggcgcccgg gcgccgcttg     21420
     gtcaacgcgt acggccccag cgaggcgacg atcatgtcgt ccatcaccga acccctccgc     21480
     gccggcgaac cggtcaccat cggcggcccg agccgcgggg tgcgggcgct cgtgctggac     21540
     gggcggctgc ggccggtgcc ggtcggggtg ccgggcgaac tgtacgtcgg gggaccgagc     21600
     ctggcccgcg gctacctggg acgaccggga ctgaccgccg aacgcttcgt cgccgacccg     21660
     tacggcgagc ccggcgacct catgtaccgc accggcgacc tcgtccggtg gcgggaggac     21720
     cgcgtcctcg atttcgtcgg ccgcaccgac caccaggtga agatccgcgg attccggatc     21780
     gaactcggcg agatcgacgc cgccctcacc gcacacccgc agatcgagta cgccaccacg     21840
     atcgggtacg agcacccgaa cggggagacc tccctcgtcg cgtacgtgct gccgttcacc     21900
     ggggaggacg tcgaccgggt cgaggtcgcg aatttcgtcg gccgcaccct gccggcctac     21960
     atggtgcccg cgtccgtcac cctcctcgac gccctgccgc tcaccccggc gggcaaactc     22020
     gaccggtccg cgctacccga accgatcttc gccgcggcgg ccacgacatt cgaggcgccc     22080
     cggaacccga tggaggtgat cgtcgccggc atcttcgcgg acatcctcgc cctgcccgag     22140
     atcggcatcc acgacagctt cttcgacctc ggcggcaact cgctgctcgc cacccaggtg     22200
     gtgtcgcgga tcaacgccgc cctcgacgtc cacgtcgggg tccgtgaggt gttcgaatcg     22260
     cccaccgtcg ccgcactcgc ggcgcggatc accgagacca ccacccacgg tgcgcggcgg     22320
     cccgcactga cggcgagggc gcgccccgaa cacattccgc tgtcgctcgc ccagcagcgg     22380
     atgtggttca tcaaccagtt cgacaccgcg tcaccggcct ataaccttcc ggtcgcactc     22440
     cggctgtcgg gcgaggtgga cctgcgcgcc atgcagatcg cgatcgccga tctcgtcgga     22500
     cggcacgagg cactgcgcac cgtctacccc gattccggcg acggcccgca ccaggtgatc     22560
     gtgcccgccg ccgacgcggt gcccgacctg acaccggtga cggcgcaccc cgacgacgtc     22620
     ctcgaacggg tgctcgcact tgtgacgacg ggcttcgacg tgacctcgga cgtgccgctg     22680
     cgggcgcgga tgtaccgcgt cggcgccgac gactacgtgc tcgtcatggt cgcccaccac     22740
     atctcggggg acggctggtc gctcgccccg ctggcccgcg acgtcatgct cgcctacacc     22800
     gcccgcaccg agggccacgt ccccctctgg acgccgctgc cggtgcagta cgccgactac     22860
     agcctgtggc agcgggaact cctcggcgac gaggccgacc ccgaatcggt tgccgccgaa     22920
     cagatcgcgt actggacccg caccctggac gggctgccgg accggctgtc cctgccgacc     22980
     gaccggccgc ggcccgccgt cgcatcccac cggggcgcgc acgtgccgtt caccatcgac     23040
     gccgccaccc accgcgcact gctgaccctc gcgcgcggca ggaacacctc gctgttcatg     23100
     gtgatgcaca ccgcgctcgc ggtactcctc gcgcgactga gcaacgaatc cgacatcgcc     23160
     gtcggcgccc ccatcgccgg ccgtggggag gaatccctcg acgaactcgt cggcatgttc     23220
     gtgaacaccc tggtcctgcg cacccacgtc gacctcgcga gttcgttcgc ggacagcctg     23280
     aacgtcgcac ggtccaccga tctgagcgcg ttcgcgcact cggacatccc gttcgagcgc     23340
     ctcgtcgacg tgctgaaccc ggcccgttcg cgctcgcacc acccactgtt ccaggtggcg     23400
     ttctcgttcc agaacctcgc caccgccaca ctcgaacttc ccgggctgca cgtcgaggga     23460
     ctcgacgtgc cgaacacgat ctccaccttc gacctgcatc tgacactgtc ggagaagcac     23520
     gacgccgacg gcaccccgga cgtgatcgag gcccagttca cctacgccac cgacctcttc     23580
     gacgacacga ccgtccgggc gttcgccgaa cgcttcaccc gcatcctcga gtcggtcgtg     23640
     cgggatccgg acctcgcggt cggtgccatc gacctcctgg gcggtgccga gcggcagtcg     23700
     gtgatcgccg aattcaacga caccgctgtc gatctgccgc cgacgaccct cgccgacctg     23760
     ttctccgccc aggcggtgcg cacacccgat taccccgcgg tgttcttcga gggcaccgaa     23820
     ctgacgtact ccgagttcga ccgccgcgtc gatgcgctcg cccaccggct gatcgattcc     23880
     ggtgtgggac cggacacggt ggtggggctc gcgatgaacc ggtcgatcga actgctcgcc     23940
     gggatgtacg cggtgttgcg ggccggcggc gcgtacctgc cgatcgatct cggccatccc     24000
     gccgaccggc tggcgtacgt gctggagacg gcacgcccgg tgtgcgtcct caccacgtcc     24060
     ccggacggtt tcaccgccga gaacgtcccc gtgatcgaga tcgacaccct cgacctcacc     24120
     ggttccccac gcggaccggt gacggacgcg caccgccgcg ccccgctgcg accggagaac     24180
     acggcgtatc tgatcttcac gtccgggtcc accggccgac ccaagggtgt cgcggtgtcg     24240
     cacgccgcca tcgcgaacca actccgctgg aagcagcacg aatacccgct cgacaccacc     24300
     gacgcggtcg tccagaagac tccggtgacg ttcgacctgt cggtgtggga actgttctgg     24360
     ccgctgatgt cgggggcccg gctcgtcatc tcccgcccgg acggacaccg cgacccggcc     24420
     tacctggcgg acctgatgcg tcagcagcgc gtcacgacag cacatttcgt gccgtccctg     24480
     ctggaggcgt tcatcccgga tgcgggggag cagccgactc tgcgccgggt cctgtgcatc     24540
     ggcgaggcgc tgcccgtcga caccgccgcc cgcttccgca gccggttcgc ctccgtcgcc     24600
     ctgcacaacc tgtacgggcc caccgaggcg gccgtgtccg tgaccgcctg gacccacacg     24660
     gacgtcgaca ccgacaccgt ccccatcggc ggaccggaat ggaacacgca ggccttcgtg     24720
     ctggacgccc ggctgaaccc ggtccccgtc ggggtggccg gggagctgta cctggccggt     24780
     gaccagctgg cccgcggtta cgtcgcccgc accgacctga ccgccgagcg cttcgtcgcg     24840
     aacccgttcg gcgcacccgg tgcacggctc tatcgcaccg gtgacgtggt tcgctggcgc     24900
     atccggggca cgacgggggt cctcgagtat ctcgaacgct ccgacttcca ggtgaaggtc     24960
     cgcggattcc ggatcgaact cggcgagatc gagtcggccc tcattcggtc cgcaggagtg     25020
     gggcaggccg tcgtggtcgc ccaccggaac ccgcacaccg gaaccgccct ggtcgcctac     25080
     gtggtccccg aggacggctc gaccgtcgat cccaccgcgg tgctggccga cgtcggcgcc     25140
     gcggtgccga gctacatggt gcccgccgcc ctcgtcgtgc tcgcggaact accgctgacc     25200
     gcgaacggaa aactcgaccg caaggcgctt cccgcgcccg acttcgcttc ggcggcagcc     25260
     gaataccgcg cgcccgccac acccaccgag gagatcgtcg ccgccgtgta cgccgacgtg     25320
     ctcggcgtcg aacaggtcgg gaccgccgcg aacttcttcg acctcggtgg caactccctc     25380
     gtcgccaccc gggtggtcgc ccggctgtcc gagacgctcg gccggcgcgt cgagattcgg     25440
     tccctgttcg aggcgcccgc cgtcggcgct cttgcggcgc tgctggactc gacggacgcg     25500
     accgcaccca cccgcccggc gctgaccccg gccgtgcgcc ccgaactgct cccgctgtcc     25560
     tcggcgcagc aacggatgtg gttcctcaac cggttcgacc cggactccgc cgtccacaac     25620
     atccccgtgg cggtccggct gtcgggcgtc ctcgacgtcg acgcactgca gcacgcggtc     25680
     gccgacgtcc tccaccgcca cgagtcgctg cggacgatct acccggactc cgccgacgga     25740
     ccgcaccagg tgatcctgtc caccgaccgg gtcggggccg aaacgtccgt cgacgcggcc     25800
     gacgaggccg cactacccgc cctgatcgcc gacctggtga ccaccggatt cgacgtcacc     25860
     gcggaggttc cggtacgggt gcggatcttc cggatctccg cgacggagca cgtcctcgcc     25920
     gtggtggtcc accacatctc cggcgacggc tggtcgatgg cgccgatggt gcgggacgtg     25980
     atggcggcgt attcggcgcg ctcggcgggc acgagcccgg actgggcgcc gctgccggtg     26040
     cagtacgccg actacgccct gtggcagcgg gatctcctcg gcgacgagac cgatcccgac     26100
     tcggtggcgg cgcggcaact cgcgttctgg acgcagaccc tcgcgggcgc gccggatcag     26160
     ctggatctgc ccaccgaccg gccgcgtccc gcggtcgcgt cgtaccgcgg cggcaccgtc     26220
     gacttcaccg tgccggccga tctgcacggc acggtggtgg gtgcggcgcg ggacgcgaac     26280
     gcgtccgtgt tcatggtcgt gcactcggcg ctcgcggtgc tgctgagccg gctcgccggt     26340
     tccggggaca tctccatcgg cacccccgtc gcgggtcgcg gcgaacgcga actcgacgac     26400
     ctgatcggca tgttcgtcaa cacgctggtc ctgcgacagc acgtcgacgg cgggcgcacg     26460
     ttcgccgaac tcctcgccga cgtccgcgag accgatctcg ccgcgttctc ccacgccgac     26520
     gtcccgttcg agcgcctcgt cgaggtcgtc aatccgtcgc ggtccaccgg gcggcacccg     26580
     ctgttccagg tgatgctcac gttccagaac ctcgaccagg agtccctcga actcggcgac     26640
     ctgtcggtga gtggtgtcga cctcgacgtg gacatcgcca agttcgacct gcagctcacc     26700
     ctgatggagc agttcgactc cgagggaggc cccgacggga tcgccgcccg cctcacgtac     26760
     gccgcggacc tgttcgacga gccgtccgcg catgtgttcg ggcagcggtt cctgcaggtg     26820
     ctgcgggcgg cggtcgacgg tccggacacc gcggtcggcg atctcgacgt cctcggccgc     26880
     ggcgaacgga agcagatcgc cggcaccaac gcgacggcgc accccgtgct tgccggaacc     26940
     ctcgcctcgt tgttcgatac ggcggtggcg gcggaccccg accggatcgc ggtggtcttc     27000
     gaccgggacg agctgacgta cgcgaacttc gacgcccgcg tgaacaggct ggcgcgacgg     27060
     ctgatcgagc agggcgtcgg ccccgagtcg gtggtggcgg tggcgatgcg ccggtcgatc     27120
     gatctgctcg tggggatcta tgccgtcgtc aaggcgggcg gcgcctacct gccgatcgat     27180
     cccgaccatc cggtcgagcg caccgcgtac gtactcgaca ccgcacggcc cgcatgcgtg     27240
     ctggtcagcg gcgccggact cgccgacagt ggctcggtcc ccgtcgtcga catcgcatcc     27300
     gaggacctct cccggtacgg tagcgcgccg gtcaccgatc gggaccggct ccggccgctg     27360
     actgcggcga acacggcgta tgtgatcttc acgtccgggt cgacgggccg tccgaagggg     27420
     gtcgcggtca cgcacggtgc gatcgtgaac cgtctgctgt ggatgcagca cgaatacgcg     27480
     ctgaccagcg cggatgttgt tttgcagaag acgccggtga cgttcgacgt gtcggtgtgg     27540
     gagctgttct ggccgctgca ggtgggggcg tcgatggtga tcgccgcccc cgacggacat     27600
     cgcgatccgc ggtatctgac tgggctggtg caggaacgtc acgtgacgac catgcacttc     27660
     gtgccgtcga tgttgtcggt gttcactgcc gaacctgctg tggcggtgtg tgattcgttg     27720
     cggttggtgt tctgttcggg ggaggcgctg acgccggagc aggtgtcgcg gttccggggg     27780
     gtcagtggtg cgggtctgca caatctgtac ggtccgacgg aggctgcggt cgatgtgacg     27840
     ttctgggaaa ccggtgagtc ggacacgcac agtgtcccga tcggtcgtcc ggtgtggaac     27900
     acgcaggtgc atgtgctcga tgcgcggttg catccggtgc cgaacggggt ggcgggggag     27960
     ttgtatctcg cgggtgagca gttggcgcgg gggtatctcg gccgggtcga cctcacctcg     28020
     gaccgattcg tggcgaatcc gttcgtcgcg ggtgggcgga tgtaccggac gggggatctg     28080
     gtgcgtcgcc ggggtgatgg ggctctggag tatctggggc gtacggattt ccaggtgaaa     28140
     ttgcgggggc agcggatcga gttgggggag atcgagtcgg cgctggaggc gcatccggac     28200
     gtcgtgcagg cggtggtggt ggtgcaccgg gacgagcgcg gcgacgaagc gctcgtcgcg     28260
     tacctggtgg gacggcgcgc ggccgagtgg tccgacgtgc gcgcacacct gtcgacacga     28320
     gtcccgtcgt acatgatccc ggcgcgcgtc gtgcacctgg acaccctgcc gctgtcggtg     28380
     aacggcaaac tggaccgcaa ggccctgccc gcaccggaag tccgctcggc cgccgccgag     28440
     tatcagcctc cacgatcggc ggccgaacgg gctgtcgcca cggtgttcgg cgaggtcctc     28500
     gaaatcgacc gggtcggagc cacggacagc ttcttcgacc tcgggggtaa ctcgctgatc     28560
     gccacccgcg tcgcggccgc gctcgggtcc gagctgggca tcgacttccc gctgcagtgg     28620
     atgttcagcg accccacacc gcggtcgctg gggcaacgta tccagaacgc ggcgatcgac     28680
     ggagtgcccg gcgccggtgc ctcgctcgac gtgctgctcc cgatccgcac ccgcgggacg     28740
     gcggagccgg tgttctgcgt ccacccgttc atcggactcg catggagcta cgcggggctg     28800
     agccgggaac tgaccgagga ccggccgatc tacgggctgc agtcgccggc gctgaccgag     28860
     gccgagccgc acccgggcac catcaccgac ttcgcggatc gctacgtccg cgagatccgc     28920
     tcgatccagc cgcacggccc gtaccacctg gtgggctggt cactgggtgg ggtcatcgct     28980
     cacgagatgg cggtgcagtt gcaggaggcg ggcgaagagg tgcgtctgct cgggctcctc     29040
     gacagctacg tcgggctcga ccgcagcgtg gagaacaccg cgaccaccgc ggatctgctc     29100
     ggcggtgccg gcctggacct gcccgaagac ggggttctcg acgaactctc gccggacggg     29160
     cagttcgacg ccgagcgggc ggccgctctg ctgcgggtcg tcggtggtcc gctggcggcg     29220
     ctcaccgccc cggaactcga ccggatctac cgcaacgcgc agcaggcccc cgacctgatc     29280
     gacgcacacc gtccgagggt gttcgacggc gaattggtgt tcttcaccgc cgccctcgac     29340
     gacggcttcc acgtcgaccc ggtgacgtgc tggggcccgt acgtgcgcgg aaggatcgac     29400
     gaacacccgg tggacgcgac gcactggacg atgacgacgc cggacgcgct cgccgcgatc     29460
     gcgccgcacc tcgcgcgtac gcagcgccgg ccgcggcacg ccgcgcccga ccccggccgg     29520
     gacaccgatc ccgacgacag cgcgaaccgg ccgcattcgg tgcgctga                  29568
//

If you have problems or comments...

PBIL Back to PBIL home page