(data stored in ACNUC7421 zone)

EMBL: AP011115.PE266

AP011115.PE266       Location/Qualifiers
FT   CDS_pept        286766..287383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48513"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR36"
FT                   /protein_id="BAH48513.1"
FT                   /translation="MTRSTVFRRAAIVLASAAALGMLSSGPASAAPVADFAKGAAELQA
FT                   LATEVSPAATAAVDALLGASVFIPKDVLEVGLTTPQDFMYPSPTLGCGVADKPATVTLA
FT                   SAQGGPNLFPQISATQLRFQAIPAYVAIPQSSELSVAWINLTTFQGGIVKLDDKLPIIN
FT                   TPLLSKIVDTGKGTVLATMFGTVGYADAVTCTVVPTVGTFTV"
     atgactcgtt ccaccgtctt ccgccgagcg gcaatcgttc tcgcgtccgc agccgctttg        60
     ggcatgctgt cctcgggacc ggcatcggca gcgccggtcg ccgacttcgc gaagggcgcc       120
     gccgaactgc aggcgttggc caccgaggtc tcccccgccg cgaccgccgc cgtcgacgcc       180
     cttctcggcg ccagcgtgtt catcccgaag gacgtgctcg aggtcggact caccacgccg       240
     caggacttca tgtacccgtc ccccaccctc gggtgcggcg tcgccgacaa gcccgcgacg       300
     gtcacactgg ccagcgctca gggcggaccg aacctgttcc cccagatcag cgcgacccaa       360
     cttcgcttcc aggcgatccc cgcctacgtc gcgatcccgc agtcgtccga actcagcgtc       420
     gcctggatca acctcaccac attccagggc ggcatcgtga aactcgacga caaactgccg       480
     atcatcaaca ccccgctgct gtcgaagatc gtcgacaccg gcaagggcac ggttctcgcg       540
     acgatgttcg gcacggtcgg gtacgccgac gccgtcacgt gcacggtggt cccgaccgtc       600
     ggcaccttca ccgtctga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page