(data stored in ACNUC7421 zone)

EMBL: AP011115.PE269

AP011115.PE269       Location/Qualifiers
FT   CDS_pept        288688..288972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02690"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48516"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR39"
FT                   /protein_id="BAH48516.1"
FT                   /translation="MPLFVVEYTYSPETSALRDDHRTQHRAWLTELLRRKIMRSSGPLA
FT                   SGHGALFIVDAEDEDAVARLFAHDPFAEEKLVANVQIREWAPAMGEFSE"
     atgcccctgt tcgtcgtgga gtacacgtac agccccgaga cgtcggccct gcgcgacgat        60
     caccgaactc agcaccgtgc gtggctcacc gaacttctcc gccgcaagat catgcgctcg       120
     agcggacctc tcgcgagcgg ccacggtgcg ctgttcatcg tcgacgccga ggacgaggac       180
     gcggtcgcgc gcctgttcgc gcacgatccg ttcgccgagg agaagctggt cgcgaacgtg       240
     cagattcgcg aatgggcgcc cgcgatgggc gagttcagcg agtag                       285
//

If you have problems or comments...

PBIL Back to PBIL home page