(data stored in ACNUC7421 zone)

EMBL: AP011115.PE27

AP011115.PE27        Location/Qualifiers
FT   CDS_pept        complement(23623..24150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48274"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1AS25"
FT                   /protein_id="BAH48274.1"
FT                   /translation="MTKKENHHATRDNLRDWRTPLRVDGPTAPQPAVCHLVVGFDRHPA
FT                   SHAALTYAMDLAGRLDAFLHVAHIVDVDDMPVEPDRDDWEQRFADAVEAERTEACTMLA
FT                   TLPGNWTYYSREGNPAQLLTTIAEANDALMIIIGTSRGGVMSLFERFLGESVSSKLVHH
FT                   ARRPVLLVPVAG"
     atgaccaaga aggaaaatca ccacgccacc cgggacaatc tgcgggactg gcgcaccccg        60
     ctgcgcgtgg acggacccac cgccccgcaa cccgcggtgt gccatctggt cgtcggcttt       120
     gaccggcatc ccgccagcca cgccgccctg acctacgcga tggacctcgc cggccgactc       180
     gatgcttttc tgcacgtcgc ccacatcgtc gacgtcgacg acatgccggt cgaacccgac       240
     cgcgacgact gggaacaacg cttcgccgac gccgtcgaag ccgagcgcac cgaggcctgc       300
     accatgctgg ccaccctgcc cgggaactgg acctactact cgcgggaagg aaacccggca       360
     cagctgctga ccacgatcgc cgaagccaac gacgccctga tgatcatcat cggcacctcc       420
     cgcggcggtg tgatgtccct gttcgagcgg ttcctcggcg aatcggtgtc ctcgaaactg       480
     gtccaccacg cccgccgccc cgtcctgctc gtccctgttg cggggtga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page