(data stored in ACNUC7421 zone)

EMBL: AP011115.PE272

AP011115.PE272       Location/Qualifiers
FT   CDS_pept        complement(291617..292009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02720"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48519"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR42"
FT                   /protein_id="BAH48519.1"
FT                   /translation="MTTAHPRPDLAAYNDAARMTQSQLVTELRALLGAKLVAYLGKVKE
FT                   TRAVRQWADGTRTINNDTDVERLRIAYRAARLIAERDTSAVAQTWFQGLNPILDDQPPA
FT                   LLLREGDLNDVGPKVLAAARQFAAVG"
     atgacgaccg cacacccacg acccgacctc gccgcctaca acgacgcggc gcggatgacg        60
     caatcgcagc tggtcacaga gctgcgtgcg ctgctcggcg ccaagctcgt cgcgtacctc       120
     gggaaggtca aggaaacccg ggccgtccga cagtgggccg acggcacccg caccatcaat       180
     aacgacaccg acgtcgaacg actccgtatc gcctaccgtg ccgcccggct catcgccgaa       240
     cgtgacacct cggccgtggc gcagacctgg ttccagggtc tgaacccgat cctcgacgac       300
     caaccaccgg cgctgctgct gcgcgaaggc gacctcaacg acgtcggacc gaaggtcctc       360
     gcagcggcac gtcagttcgc ggcggtcgga tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page