(data stored in ACNUC7421 zone)

EMBL: AP011115.PE274

AP011115.PE274       Location/Qualifiers
FT   CDS_pept        293973..294377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48521"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR44"
FT                   /protein_id="BAH48521.1"
FT                   /translation="MGDNRPFGFDPDDLDRVIREAGEELQGVKDRIVRFLEQADSQIPW
FT                   TGVFADFARPPRAAPKPETTGETGDGVWAIYTVDGDGVARVEQVYATELDALRAHKHNI
FT                   DPHRSVRFLPYGVTVSVLDQQEESTPRETE"
     atgggcgaca acaggccgtt cgggttcgac cccgacgatc tcgaccgcgt gatccgtgag        60
     gccggcgagg aattgcaggg cgtcaaggac cggatcgtca ggttcctgga acaggcggat       120
     tcacagatcc cgtggacagg cgtgttcgcg gacttcgccc ggccgccgcg cgccgcaccg       180
     aagccggaga cgaccggcga gacgggcgac ggggtgtggg cgatctacac cgtagacggc       240
     gacggcgtcg cccgcgtcga gcaggtgtac gccaccgaac tcgatgccct ccgcgcgcac       300
     aagcacaaca tcgaccctca ccgttcggtg cggttcctcc cctacggcgt caccgtcagc       360
     gtcctcgacc agcaggagga gtcgacgccc cgggaaacgg agtga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page