(data stored in ACNUC7421 zone)

EMBL: AP011115.PE275

AP011115.PE275       Location/Qualifiers
FT   CDS_pept        294628..295134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_02750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_02750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48522"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1AR45"
FT                   /protein_id="BAH48522.1"
FT                   /translation="MSGTDPPPLVVVPPGSGHTGDLGPIGVEFKLWGRDTGGVLSVVEH
FT                   PFPVGALVPPHLHTREDEFSIVTQGAIGFRSGDREAVLESGGYITKPRGEMHAMWNAGT
FT                   VPARMIEIISPAGFEHCFLEMSELIAAGGPDVTQIAAVAERYGLQFGEPDWLPDVIARY
FT                   SLTPP"
     gtgagcggca ccgatccccc accgttggtc gtcgtgccgc cggggtccgg gcacaccggt        60
     gacctgggcc cgatcggggt cgaattcaag ctctggggtc gtgataccgg tggggtgttg       120
     tcggtcgtcg aacacccgtt cccggtcggt gcgctggtgc caccgcatct gcatacgcgg       180
     gaggacgaat tctcgatagt tactcagggt gcgatcggat tccgctccgg cgaccgggag       240
     gcggttctcg aatccggcgg atacatcaca aagccccggg gtgagatgca cgccatgtgg       300
     aacgccggca ccgtcccggc gcggatgatc gagatcatca gtccggccgg cttcgaacat       360
     tgcttcctgg agatgtccga actgatcgcc gccggcggac cggatgtcac ccagatcgcc       420
     gcagttgccg agcgctacgg tctgcaattc ggcgaacccg actggttgcc cgacgtgatc       480
     gcccgatact ccctgacacc gccgtga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page